Lineage for d2hgpk1 (2hgp K:1-138)

  1. Root: SCOP 1.75
  2. 849709Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 873626Fold d.140: Ribosomal protein S8 [56046] (1 superfamily)
    consists of 2 different alpha+beta subdomains arranged in a 4-layer structure: b/a/b/a
  4. 873627Superfamily d.140.1: Ribosomal protein S8 [56047] (1 family) (S)
  5. 873628Family d.140.1.1: Ribosomal protein S8 [56048] (1 protein)
  6. 873629Protein Ribosomal protein S8 [56049] (4 species)
  7. 873647Species Thermus thermophilus [TaxId:274] [56051] (46 PDB entries)
    Uniprot P24319
  8. 873687Domain d2hgpk1: 2hgp K:1-138 [136428]
    Other proteins in same PDB: d2hgpe1, d2hgpf1, d2hgpf2, d2hgpg1, d2hgph1, d2hgph2, d2hgpi1, d2hgpj1, d2hgpm1, d2hgpn1, d2hgpo1, d2hgpp1, d2hgpq1, d2hgpr1, d2hgps1, d2hgpt1, d2hgpu1, d2hgpv1, d2hgpw1, d2hgpx1
    automatically matched to d1fjgh_

Details for d2hgpk1

PDB Entry: 2hgp (more details), 5.5 Å

PDB Description: Crystal structure of the 70S Thermus thermophilus ribosome with translocated and rotated Shine-Dalgarno Duplex. This entry 2HGP contains 30S ribosomal subunit. The 50S ribosomal subunit can be found in PDB entry 2HGQ.
PDB Compounds: (K:) 30S ribosomal protein S8

SCOP Domain Sequences for d2hgpk1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2hgpk1 d.140.1.1 (K:1-138) Ribosomal protein S8 {Thermus thermophilus [TaxId: 274]}
mltdpiadmltrirnatrvykestdvpasrfkeeilrilaregfikgyervdvdgkpylr
vylkygprrqgpdprpeqvihhirriskpgrrvyvgvkeiprvrrglgiailstskgvlt
drearklgvggelicevw

SCOP Domain Coordinates for d2hgpk1:

Click to download the PDB-style file with coordinates for d2hgpk1.
(The format of our PDB-style files is described here.)

Timeline for d2hgpk1: