Class b: All beta proteins [48724] (180 folds) |
Fold b.22: TNF-like [49841] (1 superfamily) sandwich, 10 strands in 2 sheets; jelly-roll |
Superfamily b.22.1: TNF-like [49842] (2 families) |
Family b.22.1.1: TNF-like [49843] (15 proteins) |
Protein Tumor necrosis factor ligand superfamily member 4, OX40L [141127] (2 species) |
Species Mouse (Mus musculus) [TaxId:10090] [141129] (2 PDB entries) Uniprot P43488 58-185 |
Domain d2heyf_: 2hey F: [136365] Other proteins in same PDB: d2heyr1, d2heyr2, d2heyr3, d2heyt1, d2heyt2, d2heyt3 automated match to d2hewf1 complexed with so4 |
PDB Entry: 2hey (more details), 2 Å
SCOPe Domain Sequences for d2heyf_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2heyf_ b.22.1.1 (F:) Tumor necrosis factor ligand superfamily member 4, OX40L {Mouse (Mus musculus) [TaxId: 10090]} dppiqrlrgavtrcedgqlfissykneyqtmevqnnsvvikcdglyiiylkgsffqevki dlhfredhnpisipmlndgrrivftvvaslafkdkvyltvnapdtlcehlqindgelivv qltpgycapegsyhs
Timeline for d2heyf_: