Lineage for d2heyf_ (2hey F:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2777171Fold b.22: TNF-like [49841] (1 superfamily)
    sandwich, 10 strands in 2 sheets; jelly-roll
  4. 2777172Superfamily b.22.1: TNF-like [49842] (2 families) (S)
  5. 2777173Family b.22.1.1: TNF-like [49843] (15 proteins)
  6. 2777548Protein Tumor necrosis factor ligand superfamily member 4, OX40L [141127] (2 species)
  7. 2777551Species Mouse (Mus musculus) [TaxId:10090] [141129] (2 PDB entries)
    Uniprot P43488 58-185
  8. 2777553Domain d2heyf_: 2hey F: [136365]
    Other proteins in same PDB: d2heyr1, d2heyr2, d2heyr3, d2heyt1, d2heyt2, d2heyt3
    automated match to d2hewf1
    complexed with so4

Details for d2heyf_

PDB Entry: 2hey (more details), 2 Å

PDB Description: Crystal structure of murine OX40L bound to human OX40
PDB Compounds: (F:) Tumor necrosis factor ligand superfamily member 4

SCOPe Domain Sequences for d2heyf_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2heyf_ b.22.1.1 (F:) Tumor necrosis factor ligand superfamily member 4, OX40L {Mouse (Mus musculus) [TaxId: 10090]}
dppiqrlrgavtrcedgqlfissykneyqtmevqnnsvvikcdglyiiylkgsffqevki
dlhfredhnpisipmlndgrrivftvvaslafkdkvyltvnapdtlcehlqindgelivv
qltpgycapegsyhs

SCOPe Domain Coordinates for d2heyf_:

Click to download the PDB-style file with coordinates for d2heyf_.
(The format of our PDB-style files is described here.)

Timeline for d2heyf_: