Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.56: Phosphorylase/hydrolase-like [53162] (8 superfamilies) core: 3 layers, a/b/a ; mixed sheet of 5 strands: order 21354; strand 4 is antiparallel to the rest; contains crossover loops |
Superfamily c.56.5: Zn-dependent exopeptidases [53187] (10 families) core: mixed beta-sheet of 8 strands, order 12435867; strands 2, 6 & 7 are antiparallel to the rest |
Family c.56.5.4: Bacterial dinuclear zinc exopeptidases [53204] (18 proteins) |
Protein Deblocking aminopeptidase YhfE [142512] (1 species) contains insert beta-barrel domain |
Species Bacillus cereus [TaxId:1396] [142513] (1 PDB entry) Uniprot Q81HB5 3-73,187-348 BC0901 |
Domain d2greo2: 2gre O:5-73,O:187-348 [135557] Other proteins in same PDB: d2grea1, d2greb1, d2grec1, d2gred1, d2gree1, d2gref1, d2greg1, d2greh1, d2grei1, d2grej1, d2grek1, d2grel1, d2grem1, d2gren1, d2greo1, d2grep1 automated match to d2grea2 complexed with so4 |
PDB Entry: 2gre (more details), 2.65 Å
SCOPe Domain Sequences for d2greo2:
Sequence, based on SEQRES records: (download)
>d2greo2 c.56.5.4 (O:5-73,O:187-348) Deblocking aminopeptidase YhfE {Bacillus cereus [TaxId: 1396]} tketmelikelvsipspsgntakiinfienyvsewnvetkrnnkgaliltvkgkndaqhr lltahvdtlXdkvsvaillklikrlqdenvtlpytthflisnneeigyggnsnipeetve ylavdmgalgdgqasdeytvsicakdssgpyhyalrkhlvelaktnhieykvdiypyygs dasaairagfdvkhaligagidsshaferthessiahtealvyayvmsnlie
>d2greo2 c.56.5.4 (O:5-73,O:187-348) Deblocking aminopeptidase YhfE {Bacillus cereus [TaxId: 1396]} tketmelikelvsipspsgntakiinfienyvsewnvetkrnnkgaliltvkgkndaqhr lltahvdtlXdkvsvaillklikrlqdenvtlpytthflisnneeiipeetveylavdmg algdgdeytvsicakdssgpyhyalrkhlvelaktnhieykvdiypyygragfdvkhali gagidsshaferthessiahtealvyayvmsnlie
Timeline for d2greo2:
View in 3D Domains from other chains: (mouse over for more information) d2grea1, d2grea2, d2greb1, d2greb2, d2grec1, d2grec2, d2gred1, d2gred2, d2gree1, d2gree2, d2gref1, d2gref2, d2greg1, d2greg2, d2greh1, d2greh2, d2grei1, d2grei2, d2grej1, d2grej2, d2grek1, d2grek2, d2grel1, d2grel2, d2grem1, d2grem2, d2gren1, d2gren2, d2grep1, d2grep2 |