Lineage for d2gree2 (2gre E:2-73,E:187-348)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2495627Fold c.56: Phosphorylase/hydrolase-like [53162] (8 superfamilies)
    core: 3 layers, a/b/a ; mixed sheet of 5 strands: order 21354; strand 4 is antiparallel to the rest; contains crossover loops
  4. 2497307Superfamily c.56.5: Zn-dependent exopeptidases [53187] (10 families) (S)
    core: mixed beta-sheet of 8 strands, order 12435867; strands 2, 6 & 7 are antiparallel to the rest
  5. 2497538Family c.56.5.4: Bacterial dinuclear zinc exopeptidases [53204] (18 proteins)
  6. 2497591Protein Deblocking aminopeptidase YhfE [142512] (1 species)
    contains insert beta-barrel domain
  7. 2497592Species Bacillus cereus [TaxId:1396] [142513] (1 PDB entry)
    Uniprot Q81HB5 3-73,187-348
    BC0901
  8. 2497597Domain d2gree2: 2gre E:2-73,E:187-348 [135537]
    Other proteins in same PDB: d2grea1, d2greb1, d2grec1, d2gred1, d2gree1, d2gref1, d2greg1, d2greh1, d2grei1, d2grej1, d2grek1, d2grel1, d2grem1, d2gren1, d2greo1, d2grep1
    automated match to d2grea2
    complexed with so4

Details for d2gree2

PDB Entry: 2gre (more details), 2.65 Å

PDB Description: Crystal structure of Deblocking aminopeptidase from Bacillus cereus
PDB Compounds: (E:) Deblocking aminopeptidase

SCOPe Domain Sequences for d2gree2:

Sequence, based on SEQRES records: (download)

>d2gree2 c.56.5.4 (E:2-73,E:187-348) Deblocking aminopeptidase YhfE {Bacillus cereus [TaxId: 1396]}
ahhtketmelikelvsipspsgntakiinfienyvsewnvetkrnnkgaliltvkgknda
qhrlltahvdtlXdkvsvaillklikrlqdenvtlpytthflisnneeigyggnsnipee
tveylavdmgalgdgqasdeytvsicakdssgpyhyalrkhlvelaktnhieykvdiypy
ygsdasaairagfdvkhaligagidsshaferthessiahtealvyayvmsnlie

Sequence, based on observed residues (ATOM records): (download)

>d2gree2 c.56.5.4 (E:2-73,E:187-348) Deblocking aminopeptidase YhfE {Bacillus cereus [TaxId: 1396]}
ahhtketmelikelvsipspsgntakiinfienyvsewnvetkrnnkgaliltvkgknda
qhrlltahvdtlXdkvsvaillklikrlqdenvtlpytthflisnneeipeetveylavd
mgalsdeytvsicakdssgpyhyalrkhlvelaktnhieykvdiypyygragfdvkhali
gagidssaferthessiahtealvyayvmsnlie

SCOPe Domain Coordinates for d2gree2:

Click to download the PDB-style file with coordinates for d2gree2.
(The format of our PDB-style files is described here.)

Timeline for d2gree2: