Class b: All beta proteins [48724] (178 folds) |
Fold b.49: Domain of alpha and beta subunits of F1 ATP synthase-like [50614] (4 superfamilies) barrel, closed; n=6, S=8; greek-key Many cradle-loop superfamilies may be homologous, according to PubMed 18457946 |
Superfamily b.49.3: Aminopeptidase/glucanase lid domain [101821] (1 family) |
Family b.49.3.1: Aminopeptidase/glucanase lid domain [101822] (7 proteins) |
Protein Deblocking aminopeptidase YhfE [141387] (1 species) |
Species Bacillus cereus [TaxId:1396] [141388] (1 PDB entry) Uniprot Q81HB5 74-186 BC0901 |
Domain d2grep1: 2gre P:74-186 [135558] Other proteins in same PDB: d2grea2, d2greb2, d2grec2, d2gred2, d2gree2, d2gref2, d2greg2, d2greh2, d2grei2, d2grej2, d2grek2, d2grel2, d2grem2, d2gren2, d2greo2, d2grep2 automated match to d2grea1 complexed with so4 |
PDB Entry: 2gre (more details), 2.65 Å
SCOPe Domain Sequences for d2grep1:
Sequence, based on SEQRES records: (download)
>d2grep1 b.49.3.1 (P:74-186) Deblocking aminopeptidase YhfE {Bacillus cereus [TaxId: 1396]} gamvkeikpdgrlslsmiggfrwnsvegeyceietssgktytgtilmhqtsvhvykdage akrdeknievridervfsadevrelgievgdfvsfdprvqitesgyiksrhld
>d2grep1 b.49.3.1 (P:74-186) Deblocking aminopeptidase YhfE {Bacillus cereus [TaxId: 1396]} gamvkeikpdgrlslsmiggfrwnsvegeyceietssgktytgtilmievridervfsad evrelgievgdfvsfdprvqitesgyiksrhld
Timeline for d2grep1:
View in 3D Domains from other chains: (mouse over for more information) d2grea1, d2grea2, d2greb1, d2greb2, d2grec1, d2grec2, d2gred1, d2gred2, d2gree1, d2gree2, d2gref1, d2gref2, d2greg1, d2greg2, d2greh1, d2greh2, d2grei1, d2grei2, d2grej1, d2grej2, d2grek1, d2grek2, d2grel1, d2grel2, d2grem1, d2grem2, d2gren1, d2gren2, d2greo1, d2greo2 |