SCOP 1.73: Domain d2greo2: 2gre O:5-73,O:187-348

Lineage for d2greo2 (2gre O:5-73,O:187-348)

1. Root: SCOP 1.73

2. Class c: Alpha and beta proteins (a/b) [51349] (141 folds)

3. Fold c.56: Phosphorylase/hydrolase-like [53162] (7 superfamilies)
   core: 3 layers, a/b/a ; mixed sheet of 5 strands: order 21354; strand 4 is antiparallel to the rest; contains crossover loops

4. Superfamily c.56.5: Zn-dependent exopeptidases [53187] (8 families)
   core: mixed beta-sheet of 8 strands, order 12435867; strands 2, 6 & 7 are antiparallel to the rest

5. Family c.56.5.4: Bacterial dinuclear zinc exopeptidases [53204] (17 proteins)

6. Protein Deblocking aminopeptidase YhfE [142512] (1 species)
   contains insert beta-barrel domain

7. Species Bacillus cereus [TaxId:1396] [142513] (1 PDB entry)
   BC0901

8. Domain d2greo2: 2gre O:5-73,O:187-348 [135557]
   Other proteins in same PDB: d2grea1, d2greb1, d2grec1, d2gred1, d2gree1, d2gref1, d2greg1, d2greh1, d2grei1, d2grej1, d2grek1, d2grel1, d2grem1, d2gren1, d2greo1, d2grep1
   automatically matched to 2GRE A:3-73,A:187-348
   complexed with so4

Details for d2greo2

PDB Entry: 2gre, 2.65 Å

PDB Description: Crystal structure of Deblocking aminopeptidase from Bacillus cereus

PDB Compounds: (O:) Deblocking aminopeptidase

SCOP Domain Sequences for d2greo2:

Sequence, based on SEQRES records:

>d2greo2 c.56.5.4 (O:5-73,O:187-348) Deblocking aminopeptidase YhfE {Bacillus cereus [TaxId: 1396]}
tketmelikelvsipspsgntakiinfienyvsewnvetkrnnkgaliltvkgkndaqhr
lltahvdtlXdkvsvaillklikrlqdenvtlpytthflisnneeigyggnsnipeetve
ylavdmgalgdgqasdeytvsicakdssgpyhyalrkhlvelaktnhieykvdiypyygs
dasaairagfdvkhaligagidsshaferthessiahtealvyayvmsnlie

Sequence, based on observed residues (ATOM records):

>d2greo2 c.56.5.4 (O:5-73,O:187-348) Deblocking aminopeptidase YhfE {Bacillus cereus [TaxId: 1396]}
tketmelikelvsipspsgntakiinfienyvsewnvetkrnnkgaliltvkgkndaqhr
lltahvdtlXdkvsvaillklikrlqdenvtlpytthflisnneeiipeetveylavdmg
algdgdeytvsicakdssgpyhyalrkhlvelaktnhieykvdiypyygragfdvkhali
gagidsshaferthessiahtealvyayvmsnlie

Timeline for d2greo2:

• d2greo2 is new in SCOP 1.73
  
• d2greo2 appears in SCOP 1.75
  
• d2greo2 appears in the current release, SCOPe 2.08