Class c: Alpha and beta proteins (a/b) [51349] (141 folds) |
Fold c.56: Phosphorylase/hydrolase-like [53162] (7 superfamilies) core: 3 layers, a/b/a ; mixed sheet of 5 strands: order 21354; strand 4 is antiparallel to the rest; contains crossover loops |
Superfamily c.56.5: Zn-dependent exopeptidases [53187] (8 families) core: mixed beta-sheet of 8 strands, order 12435867; strands 2, 6 & 7 are antiparallel to the rest |
Family c.56.5.4: Bacterial dinuclear zinc exopeptidases [53204] (17 proteins) |
Protein Deblocking aminopeptidase YhfE [142512] (1 species) contains insert beta-barrel domain |
Species Bacillus cereus [TaxId:1396] [142513] (1 PDB entry) BC0901 |
Domain d2gref2: 2gre F:3-73,F:187-348 [135539] Other proteins in same PDB: d2grea1, d2greb1, d2grec1, d2gred1, d2gree1, d2gref1, d2greg1, d2greh1, d2grei1, d2grej1, d2grek1, d2grel1, d2grem1, d2gren1, d2greo1, d2grep1 automatically matched to 2GRE A:3-73,A:187-348 complexed with so4 |
PDB Entry: 2gre (more details), 2.65 Å
SCOP Domain Sequences for d2gref2:
Sequence, based on SEQRES records: (download)
>d2gref2 c.56.5.4 (F:3-73,F:187-348) Deblocking aminopeptidase YhfE {Bacillus cereus [TaxId: 1396]} hhtketmelikelvsipspsgntakiinfienyvsewnvetkrnnkgaliltvkgkndaq hrlltahvdtlXdkvsvaillklikrlqdenvtlpytthflisnneeigyggnsnipeet veylavdmgalgdgqasdeytvsicakdssgpyhyalrkhlvelaktnhieykvdiypyy gsdasaairagfdvkhaligagidsshaferthessiahtealvyayvmsnlie
>d2gref2 c.56.5.4 (F:3-73,F:187-348) Deblocking aminopeptidase YhfE {Bacillus cereus [TaxId: 1396]} hhtketmelikelvsipspsgntakiinfienyvsewnvetkrnnkgaliltvkgkndaq hrlltahvdtlXdkvsvaillklikrlqdenvtlpytthflisnnesnipeetveylavd mgalgdgdeytvsicakdssgpyhyalrkhlvelaktnhieykvdiypyyragfdvkhal igagidsshaferthessiahtealvyayvmsnlie
Timeline for d2gref2:
View in 3D Domains from other chains: (mouse over for more information) d2grea1, d2grea2, d2greb1, d2greb2, d2grec1, d2grec2, d2gred1, d2gred2, d2gree1, d2gree2, d2greg1, d2greg2, d2greh1, d2greh2, d2grei1, d2grei2, d2grej1, d2grej2, d2grek1, d2grek2, d2grel1, d2grel2, d2grem1, d2grem2, d2gren1, d2gren2, d2greo1, d2greo2, d2grep1, d2grep2 |