Lineage for d2grem1 (2gre M:74-186)

  1. Root: SCOP 1.73
  2. 651986Class b: All beta proteins [48724] (165 folds)
  3. 671687Fold b.49: Domain of alpha and beta subunits of F1 ATP synthase-like [50614] (3 superfamilies)
    barrel, closed; n=6, S=8; greek-key
  4. 671859Superfamily b.49.3: Aminopeptidase/glucanase lid domain [101821] (1 family) (S)
  5. 671860Family b.49.3.1: Aminopeptidase/glucanase lid domain [101822] (7 proteins)
  6. 671869Protein Deblocking aminopeptidase YhfE [141387] (1 species)
  7. 671870Species Bacillus cereus [TaxId:1396] [141388] (1 PDB entry)
    BC0901
  8. 671883Domain d2grem1: 2gre M:74-186 [135552]
    Other proteins in same PDB: d2grea2, d2greb2, d2grec2, d2gred2, d2gree2, d2gref2, d2greg2, d2greh2, d2grei2, d2grej2, d2grek2, d2grel2, d2grem2, d2gren2, d2greo2, d2grep2
    automatically matched to 2GRE A:74-186
    complexed with so4

Details for d2grem1

PDB Entry: 2gre (more details), 2.65 Å

PDB Description: Crystal structure of Deblocking aminopeptidase from Bacillus cereus
PDB Compounds: (M:) Deblocking aminopeptidase

SCOP Domain Sequences for d2grem1:

Sequence, based on SEQRES records: (download)

>d2grem1 b.49.3.1 (M:74-186) Deblocking aminopeptidase YhfE {Bacillus cereus [TaxId: 1396]}
gamvkeikpdgrlslsmiggfrwnsvegeyceietssgktytgtilmhqtsvhvykdage
akrdeknievridervfsadevrelgievgdfvsfdprvqitesgyiksrhld

Sequence, based on observed residues (ATOM records): (download)

>d2grem1 b.49.3.1 (M:74-186) Deblocking aminopeptidase YhfE {Bacillus cereus [TaxId: 1396]}
gamvkeikpdgrlslsmiggfrwnsvegeyceietssgktytgtilmievridervfsad
evrelgievgdfvsfdprvqitesgyiksrhld

SCOP Domain Coordinates for d2grem1:

Click to download the PDB-style file with coordinates for d2grem1.
(The format of our PDB-style files is described here.)

Timeline for d2grem1: