Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
Fold d.15: beta-Grasp (ubiquitin-like) [54235] (15 superfamilies) core: beta(2)-alpha-beta(2); mixed beta-sheet 2143 |
Superfamily d.15.1: Ubiquitin-like [54236] (11 families) |
Family d.15.1.1: Ubiquitin-related [54237] (39 proteins) Pfam PF00240 |
Protein automated matches [190118] (16 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [189560] (113 PDB entries) |
Domain d2g4dd_: 2g4d D: [134591] Other proteins in same PDB: d2g4da1, d2g4dc_ automated match to d1y8rc_ mutant |
PDB Entry: 2g4d (more details), 2.8 Å
SCOPe Domain Sequences for d2g4dd_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2g4dd_ d.15.1.1 (D:) automated matches {Human (Homo sapiens) [TaxId: 9606]} eyiklkvigqdsseihfkvkmtthlkklkesycqrqgvpmnslrflfegqriadnhtpke lgmeeedvievyqeqtgg
Timeline for d2g4dd_: