Lineage for d2fyuf1 (2fyu F:5-110)

  1. Root: SCOP 1.73
  2. 744527Class f: Membrane and cell surface proteins and peptides [56835] (50 folds)
  3. 746353Fold f.27: 14 kDa protein of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) [81525] (1 superfamily)
    membrane-associated alpha-helical protein; no transmembrane helices
  4. 746354Superfamily f.27.1: 14 kDa protein of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) [81524] (1 family) (S)
    location - matrix side of the bc1 complex
  5. 746355Family f.27.1.1: 14 kDa protein of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) [81523] (1 protein)
    probably important for the complex assembly, caps the matrix face of cytochrome b
  6. 746356Protein 14 kDa protein of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) [81522] (3 species)
  7. 746368Species Cow (Bos taurus) [TaxId:9913] [81519] (17 PDB entries)
  8. 746375Domain d2fyuf1: 2fyu F:5-110 [134400]
    Other proteins in same PDB: d2fyua1, d2fyua2, d2fyub1, d2fyub2, d2fyuc1, d2fyuc2, d2fyud1, d2fyud2, d2fyug1, d2fyuh1, d2fyui1, d2fyuj1
    automatically matched to d1l0lf_
    complexed with fdn, fes, hem

Details for d2fyuf1

PDB Entry: 2fyu (more details), 2.26 Å

PDB Description: Crystal structure of bovine heart mitochondrial bc1 with jg144 inhibitor
PDB Compounds: (F:) Hypothetical protein LOC616871

SCOP Domain Sequences for d2fyuf1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2fyuf1 f.27.1.1 (F:5-110) 14 kDa protein of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) {Cow (Bos taurus) [TaxId: 9913]}
avsassrwlegirkwyynaagfnklglmrddtihenddvkeairrlpenlyddrvfrikr
aldlsmrqqilpkeqwtkyeedksylepylkevirerkereewakk

SCOP Domain Coordinates for d2fyuf1:

Click to download the PDB-style file with coordinates for d2fyuf1.
(The format of our PDB-style files is described here.)

Timeline for d2fyuf1: