SCOP 1.73: Domain d2fyuf1: 2fyu F:5-110

Lineage for d2fyuf1 (2fyu F:5-110)

1. Root: SCOP 1.73

2. Class f: Membrane and cell surface proteins and peptides [56835] (50 folds)

3. Fold f.27: 14 kDa protein of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) [81525] (1 superfamily)
   membrane-associated alpha-helical protein; no transmembrane helices

4. Superfamily f.27.1: 14 kDa protein of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) [81524] (1 family)
   location - matrix side of the bc1 complex

5. Family f.27.1.1: 14 kDa protein of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) [81523] (1 protein)
   probably important for the complex assembly, caps the matrix face of cytochrome b

6. Protein 14 kDa protein of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) [81522] (3 species)

7. Species Cow (Bos taurus) [TaxId:9913] [81519] (17 PDB entries)

8. Domain d2fyuf1: 2fyu F:5-110 [134400]
   Other proteins in same PDB: d2fyua1, d2fyua2, d2fyub1, d2fyub2, d2fyuc1, d2fyuc2, d2fyud1, d2fyud2, d2fyug1, d2fyuh1, d2fyui1, d2fyuj1
   automatically matched to d1l0lf_
   complexed with fdn, fes, hem

Details for d2fyuf1

PDB Entry: 2fyu, 2.26 Å

PDB Description: Crystal structure of bovine heart mitochondrial bc1 with jg144 inhibitor

PDB Compounds: (F:) Hypothetical protein LOC616871

SCOP Domain Sequences for d2fyuf1:

Sequence; same for both SEQRES and ATOM records:

>d2fyuf1 f.27.1.1 (F:5-110) 14 kDa protein of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) {Cow (Bos taurus) [TaxId: 9913]}
avsassrwlegirkwyynaagfnklglmrddtihenddvkeairrlpenlyddrvfrikr
aldlsmrqqilpkeqwtkyeedksylepylkevirerkereewakk

Timeline for d2fyuf1:

• d2fyuf1 is new in SCOP 1.73
  
• d2fyuf1 appears in SCOP 1.75
  
• d2fyuf1 appears in the current release, SCOPe 2.08, called d2fyuf_