Lineage for d2fyuj1 (2fyu J:2-61)

  1. Root: SCOP 1.73
  2. 744527Class f: Membrane and cell surface proteins and peptides [56835] (50 folds)
  3. 745533Fold f.23: Single transmembrane helix [81407] (30 superfamilies)
    not a true fold
  4. 745953Superfamily f.23.14: Subunit X (non-heme 7 kDa protein) of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) [81514] (1 family) (S)
  5. 745954Family f.23.14.1: Subunit X (non-heme 7 kDa protein) of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) [81513] (1 protein)
  6. 745955Protein Subunit X (non-heme 7 kDa protein) of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) [81512] (3 species)
    interacts with cytochrome c1 and ISP
  7. 745967Species Cow (Bos taurus) [TaxId:9913] [81509] (18 PDB entries)
  8. 745973Domain d2fyuj1: 2fyu J:2-61 [134404]
    Other proteins in same PDB: d2fyua1, d2fyua2, d2fyub1, d2fyub2, d2fyuc1, d2fyuc2, d2fyud1, d2fyud2, d2fyuf1, d2fyug1, d2fyuh1, d2fyui1
    automatically matched to d1be3j_
    complexed with fdn, fes, hem

Details for d2fyuj1

PDB Entry: 2fyu (more details), 2.26 Å

PDB Description: Crystal structure of bovine heart mitochondrial bc1 with jg144 inhibitor
PDB Compounds: (J:) Ubiquinol-cytochrome c reductase complex 7.2 kDa protein

SCOP Domain Sequences for d2fyuj1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2fyuj1 f.23.14.1 (J:2-61) Subunit X (non-heme 7 kDa protein) of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) {Cow (Bos taurus) [TaxId: 9913]}
aptltarlysllfrrtstfaltivvgalfferafdqgadaiyehinegklwkhikhkyen

SCOP Domain Coordinates for d2fyuj1:

Click to download the PDB-style file with coordinates for d2fyuj1.
(The format of our PDB-style files is described here.)

Timeline for d2fyuj1: