Lineage for d2fyua1 (2fyu A:1-233)

  1. Root: SCOP 1.73
  2. 713694Class d: Alpha and beta proteins (a+b) [53931] (334 folds)
  3. 739189Fold d.185: LuxS/MPP-like metallohydrolase [63410] (1 superfamily)
    core: beta-alpha-beta(2)-alpha(2); 2 layers: alpha/beta
  4. 739190Superfamily d.185.1: LuxS/MPP-like metallohydrolase [63411] (2 families) (S)
    Share the same "active site motif" HxxEH located in the first core helix, but differ in one of the zinc-binding residues
  5. 739191Family d.185.1.1: MPP-like [63412] (6 proteins)
    Common fold elaborated with many additional structures; duplication: each family member consists of two similar domains of beta(2)-alpha(2)-beta(2)-alpha(5)-beta structure, but only the N-terminal domain of MPP beta chain binds the catalytic metal
  6. 739192Protein Cytochrome bc1 core subunit 1 [63408] (3 species)
  7. 739213Species Cow (Bos taurus) [TaxId:9913] [55997] (18 PDB entries)
  8. 739226Domain d2fyua1: 2fyu A:1-233 [134392]
    Other proteins in same PDB: d2fyub1, d2fyub2, d2fyuc1, d2fyuc2, d2fyud1, d2fyud2, d2fyuf1, d2fyug1, d2fyuh1, d2fyui1, d2fyuj1
    automatically matched to d1be3a1
    complexed with fdn, fes, hem

Details for d2fyua1

PDB Entry: 2fyu (more details), 2.26 Å

PDB Description: Crystal structure of bovine heart mitochondrial bc1 with jg144 inhibitor
PDB Compounds: (A:) Ubiquinol-cytochrome-c reductase complex core protein I, mitochondrial

SCOP Domain Sequences for d2fyua1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2fyua1 d.185.1.1 (A:1-233) Cytochrome bc1 core subunit 1 {Cow (Bos taurus) [TaxId: 9913]}
tatyaqalqsvpetqvsqldnglrvaseqssqptctvgvwidagsryeseknngagyfve
hlafkgtknrpgnalekevesmgahlnaystrehtayyikalskdlpkavelladivqnc
sledsqiekerdvilqelqendtsmrdvvfnylhatafqgtplaqsvegpsenvrklsra
dlteylsrhykaprmvlaaagglehrqlldlaqkhfsglsgtydedavptlsp

SCOP Domain Coordinates for d2fyua1:

Click to download the PDB-style file with coordinates for d2fyua1.
(The format of our PDB-style files is described here.)

Timeline for d2fyua1: