Lineage for d2fyui1 (2fyu I:1-57)

  1. Root: SCOP 1.73
  2. 713694Class d: Alpha and beta proteins (a+b) [53931] (334 folds)
  3. 739154Fold d.184: Non-globular alpha+beta subunits of globular proteins [56567] (1 superfamily)
    not a true fold
  4. 739155Superfamily d.184.1: Non-globular alpha+beta subunits of globular proteins [56568] (3 families) (S)
    not a true superfamily
  5. 739170Family d.184.1.3: Ubiquinol-cytochrome c reductase 8 kDa protein [90077] (1 protein)
    beta-hairpin and a short alpha-helix bound to the core subunits
  6. 739171Protein Ubiquinol-cytochrome c reductase 8 kDa protein [90078] (1 species)
  7. 739172Species Cow (Bos taurus) [TaxId:9913] [90079] (14 PDB entries)
    there are other PDB entries with lower resolution structures of the Ubiquinol-cytochrome c reductase complex, in which this subunit has incomplete and probably mistraced structure that is not classified in scop
  8. 739177Domain d2fyui1: 2fyu I:1-57 [134403]
    Other proteins in same PDB: d2fyua1, d2fyua2, d2fyub1, d2fyub2, d2fyuc1, d2fyuc2, d2fyud1, d2fyud2, d2fyuf1, d2fyug1, d2fyuh1, d2fyuj1
    automatically matched to d1l0li_
    complexed with fdn, fes, hem

Details for d2fyui1

PDB Entry: 2fyu (more details), 2.26 Å

PDB Description: Crystal structure of bovine heart mitochondrial bc1 with jg144 inhibitor
PDB Compounds: (I:) Ubiquinol-cytochrome c reductase iron-sulfur subunit, mitochondrial

SCOP Domain Sequences for d2fyui1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2fyui1 d.184.1.3 (I:1-57) Ubiquinol-cytochrome c reductase 8 kDa protein {Cow (Bos taurus) [TaxId: 9913]}
mlsvaarsgpfapvlsatsrgvagalrplvqaavpatsespvldlkrsvlcreslrg

SCOP Domain Coordinates for d2fyui1:

Click to download the PDB-style file with coordinates for d2fyui1.
(The format of our PDB-style files is described here.)

Timeline for d2fyui1: