SCOPe 2.05: Domain d2fjla1: 2fjl A:1-37,A:87-150

Lineage for d2fjla1 (2fjl A:1-37,A:87-150)

1. Root: SCOPe 2.05

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.55: PH domain-like barrel [50728] (2 superfamilies)
   barrel, partly opened; n*=6, S*=12; meander; capped by an alpha-helix

4. Superfamily b.55.1: PH domain-like [50729] (14 families)

5. Family b.55.1.1: Pleckstrin-homology domain (PH domain) [50730] (48 proteins)
   Pfam PF00169

6. Protein Phosphoinositide phospholipase C, PLC-gamma-1 [141413] (1 species)
   contains split PH domain

7. Species Norway rat (Rattus norvegicus) [TaxId:10116] [141414] (1 PDB entry)
   Uniprot P10686 489-525,870-933

8. Domain d2fjla1: 2fjl A:1-37,A:87-150 [133611]
   split PH domain; disordered bits of insert domains and an artificial linker are excluded

Details for d2fjla1

PDB Entry: 2fjl

PDB Description: solution structure of the split ph domain in phospholipase c-gamma1

PDB Compounds: (A:) 1-phosphatidylinositol-4,5-bisphosphate phosphodiesterase gamma 1

SCOPe Domain Sequences for d2fjla1:

Sequence; same for both SEQRES and ATOM records:

>d2fjla1 b.55.1.1 (A:1-37,A:87-150) Phosphoinositide phospholipase C, PLC-gamma-1 {Norway rat (Rattus norvegicus) [TaxId: 10116]}
sikngilyledpvnhewyphyfvltsskiyyseetssXdllrgvldvpacqiairpegkn
nrlfvfsismpsvaqwsldvaadsqeelqdwvkkirevaqta

Timeline for d2fjla1:

• d2fjla1 first appeared in SCOP 1.73
  
• d2fjla1 appears in SCOPe 2.04
  
• d2fjla1 appears in SCOPe 2.06
  
• d2fjla1 appears in the current release, SCOPe 2.08