Class b: All beta proteins [48724] (180 folds) |
Fold b.55: PH domain-like barrel [50728] (3 superfamilies) barrel, partly opened; n*=6, S*=12; meander; capped by an alpha-helix |
Superfamily b.55.1: PH domain-like [50729] (14 families) |
Family b.55.1.1: Pleckstrin-homology domain (PH domain) [50730] (48 proteins) Pfam PF00169 |
Protein Phosphoinositide phospholipase C, PLC-gamma-1 [141413] (1 species) contains split PH domain |
Species Norway rat (Rattus norvegicus) [TaxId:10116] [141414] (1 PDB entry) Uniprot P10686 489-525,870-933 |
Domain d2fjla1: 2fjl A:1-37,A:87-150 [133611] split PH domain; disordered bits of insert domains and an artificial linker are excluded |
PDB Entry: 2fjl (more details)
SCOPe Domain Sequences for d2fjla1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2fjla1 b.55.1.1 (A:1-37,A:87-150) Phosphoinositide phospholipase C, PLC-gamma-1 {Norway rat (Rattus norvegicus) [TaxId: 10116]} sikngilyledpvnhewyphyfvltsskiyyseetssXdllrgvldvpacqiairpegkn nrlfvfsismpsvaqwsldvaadsqeelqdwvkkirevaqta
Timeline for d2fjla1: