Lineage for d2fjla1 (2fjl A:1-37,A:87-150)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2803065Fold b.55: PH domain-like barrel [50728] (3 superfamilies)
    barrel, partly opened; n*=6, S*=12; meander; capped by an alpha-helix
  4. 2803066Superfamily b.55.1: PH domain-like [50729] (14 families) (S)
  5. 2803067Family b.55.1.1: Pleckstrin-homology domain (PH domain) [50730] (48 proteins)
    Pfam PF00169
  6. 2803208Protein Phosphoinositide phospholipase C, PLC-gamma-1 [141413] (1 species)
    contains split PH domain
  7. 2803209Species Norway rat (Rattus norvegicus) [TaxId:10116] [141414] (1 PDB entry)
    Uniprot P10686 489-525,870-933
  8. 2803210Domain d2fjla1: 2fjl A:1-37,A:87-150 [133611]
    split PH domain; disordered bits of insert domains and an artificial linker are excluded

Details for d2fjla1

PDB Entry: 2fjl (more details)

PDB Description: solution structure of the split ph domain in phospholipase c-gamma1
PDB Compounds: (A:) 1-phosphatidylinositol-4,5-bisphosphate phosphodiesterase gamma 1

SCOPe Domain Sequences for d2fjla1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2fjla1 b.55.1.1 (A:1-37,A:87-150) Phosphoinositide phospholipase C, PLC-gamma-1 {Norway rat (Rattus norvegicus) [TaxId: 10116]}
sikngilyledpvnhewyphyfvltsskiyyseetssXdllrgvldvpacqiairpegkn
nrlfvfsismpsvaqwsldvaadsqeelqdwvkkirevaqta

SCOPe Domain Coordinates for d2fjla1:

Click to download the PDB-style file with coordinates for d2fjla1.
(The format of our PDB-style files is described here.)

Timeline for d2fjla1: