SCOPe 2.08: Domain d2f5ya1: 2f5y A:15-95

Lineage for d2f5ya1 (2f5y A:15-95)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.36: PDZ domain-like [50155] (1 superfamily)
   contains barrel, partly opened; n*=4, S*=8; meander; capped by alpha-helix

4. Superfamily b.36.1: PDZ domain-like [50156] (7 families)
   peptide-binding domain

5. Family b.36.1.1: PDZ domain [50157] (47 proteins)
   Pfam PF00595

6. Protein Regulator of G-protein signaling 3, RGS3 [117180] (2 species)

7. Species Human (Homo sapiens) [TaxId:9606] [141264] (1 PDB entry)
   Uniprot P49796 300-376

8. Domain d2f5ya1: 2f5y A:15-95 [133015]
   Other proteins in same PDB: d2f5ya2, d2f5yb3
   complexed with so4

Details for d2f5ya1

PDB Entry: 2f5y, 2.39 Å

PDB Description: Crystal Structure of the PDZ Domain from Human RGS-3

PDB Compounds: (A:) regulator of G-protein signalling 3 isoform 1

SCOPe Domain Sequences for d2f5ya1:

Sequence; same for both SEQRES and ATOM records:

>d2f5ya1 b.36.1.1 (A:15-95) Regulator of G-protein signaling 3, RGS3 {Human (Homo sapiens) [TaxId: 9606]}
ryrqitiprgkdgfgfticcdspvrvqavdsggpaeraglqqldtvlqlnerpvehwkcv
elaheirscpseiillvwrmv

Timeline for d2f5ya1:

• d2f5ya1 first appeared in SCOP 1.73
  
• d2f5ya1 appears in SCOPe 2.07