Lineage for d2f2hf2 (2f2h F:1-247)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2391115Fold b.30: Supersandwich [49993] (3 superfamilies)
    sandwich; 18 strands in 2 sheets
  4. 2391261Superfamily b.30.5: Galactose mutarotase-like [74650] (12 families) (S)
    probable carbohydrate-binding domain in enzymes acting on sugars
  5. 2391701Family b.30.5.11: Glycosyl hydrolase family 31, N-terminal domain-like [117139] (4 proteins)
    Pfam PF16863
  6. 2391718Protein Putative glucosidase YicI, N-terminal domain [117140] (1 species)
  7. 2391719Species Escherichia coli [TaxId:562] [117141] (5 PDB entries)
    Uniprot P31434
  8. 2391725Domain d2f2hf2: 2f2h F:1-247 [132839]
    Other proteins in same PDB: d2f2ha1, d2f2ha3, d2f2ha4, d2f2ha5, d2f2hb1, d2f2hb3, d2f2hb4, d2f2hb5, d2f2hc1, d2f2hc3, d2f2hc4, d2f2hc5, d2f2hd1, d2f2hd3, d2f2hd4, d2f2hd5, d2f2he1, d2f2he3, d2f2he4, d2f2he5, d2f2hf1, d2f2hf3, d2f2hf4, d2f2hf5
    automated match to d2f2ha2
    complexed with gol, mpo, so4, xtg

Details for d2f2hf2

PDB Entry: 2f2h (more details), 1.95 Å

PDB Description: Structure of the YicI thiosugar Michaelis complex
PDB Compounds: (F:) Putative family 31 glucosidase yicI

SCOPe Domain Sequences for d2f2hf2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2f2hf2 b.30.5.11 (F:1-247) Putative glucosidase YicI, N-terminal domain {Escherichia coli [TaxId: 562]}
mkisdgnwliqpglnlihplqvfeveqqdnemvvyaaprdvrertwqldtplftlrffsp
qegivgvriehfqgalnngphyplnilqdvkvtienteryaefksgnlsarvskgefwsl
dflrngeritgsqvknngyvqdtnnqrnymferldlgvgetvyglgerftalvrngqtve
twnrdggtsteqayknipfymtnrgygvlvnhpqcvsfevgsekvskvqfsveseyleyf
vidgptp

SCOPe Domain Coordinates for d2f2hf2:

Click to download the PDB-style file with coordinates for d2f2hf2.
(The format of our PDB-style files is described here.)

Timeline for d2f2hf2: