SCOPe 2.07: Domain d2f2hc1: 2f2h C:666-772

Lineage for d2f2hc1 (2f2h C:666-772)

1. Root: SCOPe 2.07

2. Class b: All beta proteins [48724] (178 folds)

3. Fold b.150: Glycolsyl hydrolase family 31 C-terminal domain-like [117124] (1 superfamily)
   sandwich; 10 strands in two sheets

4. Superfamily b.150.1: Glycolsyl hydrolase family 31 C-terminal domain [117125] (2 families)

5. Family b.150.1.1: Glycolsyl hydrolase family 31 C-terminal domain [117126] (3 proteins)

6. Protein Putative glucosidase YicI, C-terminal domain [117127] (1 species)

7. Species Escherichia coli [TaxId:562] [117128] (5 PDB entries)
   Uniprot P31434

8. Domain d2f2hc1: 2f2h C:666-772 [132826]
   Other proteins in same PDB: d2f2ha2, d2f2ha3, d2f2ha4, d2f2ha5, d2f2hb2, d2f2hb3, d2f2hb4, d2f2hb5, d2f2hc2, d2f2hc3, d2f2hc4, d2f2hc5, d2f2hd2, d2f2hd3, d2f2hd4, d2f2hd5, d2f2he2, d2f2he3, d2f2he4, d2f2he5, d2f2hf2, d2f2hf3, d2f2hf4, d2f2hf5
   automated match to d2f2ha1
   complexed with gol, mpo, so4, xtg

Details for d2f2hc1

PDB Entry: 2f2h, 1.95 Å

PDB Description: Structure of the YicI thiosugar Michaelis complex

PDB Compounds: (C:) Putative family 31 glucosidase yicI

SCOPe Domain Sequences for d2f2hc1:

Sequence; same for both SEQRES and ATOM records:

>d2f2hc1 b.150.1.1 (C:666-772) Putative glucosidase YicI, C-terminal domain {Escherichia coli [TaxId: 562]}
ntllalgnndqrpdyvwhegtafhlfnlqdgheavcevpaadgsviftlkaartgntitv
tgageaknwtlclrnvvkvnglqdgsqaeseqglvvkpqgnaltitl

Timeline for d2f2hc1:

• d2f2hc1 first appeared in SCOP 1.73
  
• d2f2hc1 appears in SCOPe 2.06
  
• d2f2hc1 appears in the current release, SCOPe 2.08