Class b: All beta proteins [48724] (178 folds) |
Fold b.150: Glycolsyl hydrolase family 31 C-terminal domain-like [117124] (1 superfamily) sandwich; 10 strands in two sheets |
Superfamily b.150.1: Glycolsyl hydrolase family 31 C-terminal domain [117125] (2 families) |
Family b.150.1.1: Glycolsyl hydrolase family 31 C-terminal domain [117126] (3 proteins) |
Protein Putative glucosidase YicI, C-terminal domain [117127] (1 species) |
Species Escherichia coli [TaxId:562] [117128] (5 PDB entries) Uniprot P31434 |
Domain d2f2hf1: 2f2h F:666-772 [132838] Other proteins in same PDB: d2f2ha2, d2f2ha3, d2f2ha4, d2f2ha5, d2f2hb2, d2f2hb3, d2f2hb4, d2f2hb5, d2f2hc2, d2f2hc3, d2f2hc4, d2f2hc5, d2f2hd2, d2f2hd3, d2f2hd4, d2f2hd5, d2f2he2, d2f2he3, d2f2he4, d2f2he5, d2f2hf2, d2f2hf3, d2f2hf4, d2f2hf5 automated match to d2f2ha1 complexed with gol, mpo, so4, xtg |
PDB Entry: 2f2h (more details), 1.95 Å
SCOPe Domain Sequences for d2f2hf1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2f2hf1 b.150.1.1 (F:666-772) Putative glucosidase YicI, C-terminal domain {Escherichia coli [TaxId: 562]} ntllalgnndqrpdyvwhegtafhlfnlqdgheavcevpaadgsviftlkaartgntitv tgageaknwtlclrnvvkvnglqdgsqaeseqglvvkpqgnaltitl
Timeline for d2f2hf1:
View in 3D Domains from same chain: (mouse over for more information) d2f2hf2, d2f2hf3, d2f2hf4, d2f2hf5 |