Class b: All beta proteins [48724] (180 folds) |
Fold b.30: Supersandwich [49993] (3 superfamilies) sandwich; 18 strands in 2 sheets |
Superfamily b.30.5: Galactose mutarotase-like [74650] (12 families) probable carbohydrate-binding domain in enzymes acting on sugars |
Family b.30.5.11: Glycosyl hydrolase family 31, N-terminal domain-like [117139] (5 proteins) Pfam PF16863 |
Protein Putative glucosidase YicI, N-terminal domain [117140] (1 species) |
Species Escherichia coli [TaxId:562] [117141] (5 PDB entries) Uniprot P31434 |
Domain d2f2hf2: 2f2h F:1-247 [132839] Other proteins in same PDB: d2f2ha1, d2f2ha3, d2f2ha4, d2f2ha5, d2f2hb1, d2f2hb3, d2f2hb4, d2f2hb5, d2f2hc1, d2f2hc3, d2f2hc4, d2f2hc5, d2f2hd1, d2f2hd3, d2f2hd4, d2f2hd5, d2f2he1, d2f2he3, d2f2he4, d2f2he5, d2f2hf1, d2f2hf3, d2f2hf4, d2f2hf5 automated match to d2f2ha2 complexed with gol, mpo, so4, xtg |
PDB Entry: 2f2h (more details), 1.95 Å
SCOPe Domain Sequences for d2f2hf2:
Sequence; same for both SEQRES and ATOM records: (download)
>d2f2hf2 b.30.5.11 (F:1-247) Putative glucosidase YicI, N-terminal domain {Escherichia coli [TaxId: 562]} mkisdgnwliqpglnlihplqvfeveqqdnemvvyaaprdvrertwqldtplftlrffsp qegivgvriehfqgalnngphyplnilqdvkvtienteryaefksgnlsarvskgefwsl dflrngeritgsqvknngyvqdtnnqrnymferldlgvgetvyglgerftalvrngqtve twnrdggtsteqayknipfymtnrgygvlvnhpqcvsfevgsekvskvqfsveseyleyf vidgptp
Timeline for d2f2hf2:
View in 3D Domains from same chain: (mouse over for more information) d2f2hf1, d2f2hf3, d2f2hf4, d2f2hf5 |