![]() | Class a: All alpha proteins [46456] (290 folds) |
![]() | Fold a.156: S13-like H2TH domain [81297] (1 superfamily) core: 3-4 helices |
![]() | Superfamily a.156.1: S13-like H2TH domain [46946] (4 families) ![]() contains a helix-two turns-helix (H2TH) motif |
![]() | Family a.156.1.1: Ribosomal protein S13 [46947] (1 protein) contains 3 helices and a beta-hairpin in the core and a non-globular C-terminal extension automatically mapped to Pfam PF00416 |
![]() | Protein Ribosomal protein S13 [46948] (2 species) |
![]() | Species Thermus thermophilus [TaxId:274] [46949] (44 PDB entries) Uniprot P80377 |
![]() | Domain d2e5lm1: 2e5l M:2-123 [132037] Other proteins in same PDB: d2e5lc1, d2e5lc2, d2e5ld1, d2e5le1, d2e5le2, d2e5lf1, d2e5lg1, d2e5lh1, d2e5li1, d2e5lj1, d2e5lk1, d2e5ll1, d2e5ln1, d2e5lo1, d2e5lp1, d2e5lq1, d2e5lr1, d2e5ls1, d2e5lt1, d2e5lv1 automatically matched to d1fjgm_ complexed with zn |
PDB Entry: 2e5l (more details), 3.3 Å
SCOPe Domain Sequences for d2e5lm1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2e5lm1 a.156.1.1 (M:2-123) Ribosomal protein S13 {Thermus thermophilus [TaxId: 274]} ariagveiprnkrvdvaltyiygigkarakealektginpatrvkdlteaevvrlreyve ntwklegelraevaanikrlmdigcyrglrhrrglpvrgqrtrtnartrkgprktvagkk ka
Timeline for d2e5lm1: