Class a: All alpha proteins [46456] (290 folds) |
Fold a.156: S13-like H2TH domain [81297] (1 superfamily) core: 3-4 helices |
Superfamily a.156.1: S13-like H2TH domain [46946] (4 families) contains a helix-two turns-helix (H2TH) motif |
Family a.156.1.1: Ribosomal protein S13 [46947] (1 protein) contains 3 helices and a beta-hairpin in the core and a non-globular C-terminal extension automatically mapped to Pfam PF00416 |
Protein Ribosomal protein S13 [46948] (2 species) |
Species Thermus thermophilus [TaxId:274] [46949] (44 PDB entries) Uniprot P80377 |
Domain d1fjgm_: 1fjg M: [16293] Other proteins in same PDB: d1fjgb_, d1fjgc1, d1fjgc2, d1fjgd_, d1fjge1, d1fjge2, d1fjgf_, d1fjgg_, d1fjgh_, d1fjgi_, d1fjgj_, d1fjgk_, d1fjgl_, d1fjgn_, d1fjgo_, d1fjgp_, d1fjgq_, d1fjgr_, d1fjgs_, d1fjgt_, d1fjgv_ complexed with mg, par, scm, sry, zn |
PDB Entry: 1fjg (more details), 3 Å
SCOPe Domain Sequences for d1fjgm_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1fjgm_ a.156.1.1 (M:) Ribosomal protein S13 {Thermus thermophilus [TaxId: 274]} ariagveiprnkrvdvaltyiygigkarakealektginpatrvkdlteaevvrlreyve ntwklegelraevaanikrlmdigcyrglrhrrglpvrgqrtrtnartrkgprktvagkk kaprk
Timeline for d1fjgm_: