SCOPe 2.08: Domain d2e5lc1: 2e5l C:2-106

Lineage for d2e5lc1 (2e5l C:2-106)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.52: Alpha-lytic protease prodomain-like [54805] (10 superfamilies)
   core: alpha-beta(2)-(alpha)-beta; 2 layers: alpha/beta

4. Superfamily d.52.3: Prokaryotic type KH domain (KH-domain type II) [54814] (2 families)
   Prokaryotic and eukaryotic domains share a KH-motif but have different topologies

5. Family d.52.3.1: Prokaryotic type KH domain (KH-domain type II) [54815] (4 proteins)

6. Protein Ribosomal protein S3 N-terminal domain [54816] (4 species)

7. Species Thermus thermophilus [TaxId:274] [54817] (36 PDB entries)
   Uniprot P80372

8. Domain d2e5lc1: 2e5l C:2-106 [132025]
   Other proteins in same PDB: d2e5lc2, d2e5ld1, d2e5le1, d2e5le2, d2e5lf1, d2e5lg1, d2e5lh1, d2e5li1, d2e5lj1, d2e5lk1, d2e5ll1, d2e5lm1, d2e5ln1, d2e5lo1, d2e5lp1, d2e5lq1, d2e5lr1, d2e5ls1, d2e5lt1, d2e5lv1
   automatically matched to d1fjgc1
   complexed with zn

Details for d2e5lc1

PDB Entry: 2e5l, 3.3 Å

PDB Description: a snapshot of the 30s ribosomal subunit capturing mrna via the shine- dalgarno interaction

PDB Compounds: (C:) 30S ribosomal protein S3

SCOPe Domain Sequences for d2e5lc1:

Sequence; same for both SEQRES and ATOM records:

>d2e5lc1 d.52.3.1 (C:2-106) Ribosomal protein S3 N-terminal domain {Thermus thermophilus [TaxId: 274]}
gnkihpigfrlgitrdwesrwyagkkqyrhllledqrirgllekelysaglarvdieraa
dnvavtvhvakpgvvigrggerirvlreelakltgknvalnvqev

Timeline for d2e5lc1:

• d2e5lc1 first appeared in SCOP 1.73
  
• d2e5lc1 appears in SCOPe 2.07