Lineage for d2bmka1 (2bmk A:1-107)

  1. Root: SCOPe 2.02
  2. 1103260Class b: All beta proteins [48724] (174 folds)
  3. 1103261Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 1103262Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 1103263Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)
  6. 1104358Protein Immunoglobulin light chain kappa variable domain, VL-kappa [88519] (15 species)
    VL-kappa domains of human and mouse antibodies are clustered by the sequence similarity within the germline encoded segment and then by the size of the complementarity determining regions CDR1 and CDR2, so the clusters may correspond to putative germline families in the species genomes; VL-kappa domains with artificial or grafted exogenous CDRs are listed as engineered species
  7. 1104854Species Mouse (Mus musculus), cluster 3.2 [TaxId:10090] [88528] (44 PDB entries)
    Uniprot P04940 # KV6F_MOUSE IG KAPPA CHAIN V-VI REGION NQ2-17.4.1
  8. 1104858Domain d2bmka1: 2bmk A:1-107 [128798]
    Other proteins in same PDB: d2bmka2, d2bmkb1, d2bmkb2, d2bmkh1, d2bmkh2, d2bmkl2
    automatically matched to d1dqdl1
    complexed with iod, pdd

Details for d2bmka1

PDB Entry: 2bmk (more details), 2.3 Å

PDB Description: fab fragment of plp-dependent catalytic antibody 15a9 in complex with phosphopyridoxyl-d-alanine
PDB Compounds: (A:) fab fragment of catalytic antibody 15a9, light chain

SCOPe Domain Sequences for d2bmka1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2bmka1 b.1.1.1 (A:1-107) Immunoglobulin light chain kappa variable domain, VL-kappa {Mouse (Mus musculus), cluster 3.2 [TaxId: 10090]}
dieltqspaimaaspgekvtitcsatsgvnymhwfqqkpgtspklwiystsnlasavpar
fsgsgsgtsysltisrmeaedaatyycqqrstypftfgggtklelk

SCOPe Domain Coordinates for d2bmka1:

Click to download the PDB-style file with coordinates for d2bmka1.
(The format of our PDB-style files is described here.)

Timeline for d2bmka1: