SCOP 1.73: Domain d2bmka1: 2bmk A:1-107

Lineage for d2bmka1 (2bmk A:1-107)

1. Root: SCOP 1.73

2. Class b: All beta proteins [48724] (165 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (27 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (4 families)

5. Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (29 proteins)

6. Protein Immunoglobulin light chain kappa variable domain, VL-kappa [88519] (14 species)
   VL-kappa domains of human and mouse antibodies are clustered by the sequence similarity within the germline encoded segment and then by the size of the complementarity determining regions CDR1 and CDR2, so the clusters may correspond to putative germline families in the species genomes; VL-kappa domains with artificial or grafted exogenous CDRs are listed as engineered species

7. Species Mouse (Mus musculus), cluster 3.2 [TaxId:10090] [88528] (40 PDB entries)

8. Domain d2bmka1: 2bmk A:1-107 [128798]
   Other proteins in same PDB: d2bmka2, d2bmkl2
   automatically matched to d1dqdl1
   complexed with iod, pdd

Details for d2bmka1

PDB Entry: 2bmk, 2.3 Å

PDB Description: fab fragment of plp-dependent catalytic antibody 15a9 in complex with phosphopyridoxyl-d-alanine

PDB Compounds: (A:) fab fragment of catalytic antibody 15a9, light chain

SCOP Domain Sequences for d2bmka1:

Sequence; same for both SEQRES and ATOM records:

>d2bmka1 b.1.1.1 (A:1-107) Immunoglobulin light chain kappa variable domain, VL-kappa {Mouse (Mus musculus), cluster 3.2 [TaxId: 10090]}
dieltqspaimaaspgekvtitcsatsgvnymhwfqqkpgtspklwiystsnlasavpar
fsgsgsgtsysltisrmeaedaatyycqqrstypftfgggtklelk

Timeline for d2bmka1:

• d2bmka1 is new in SCOP 1.73
  
• d2bmka1 appears in SCOP 1.75
  
• d2bmka1 appears in the current release, SCOPe 2.08