SCOPe 2.05: Domain d2b4jb_: 2b4j B:

Lineage for d2b4jb_ (2b4j B:)

1. Root: SCOPe 2.05

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
   3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest

4. Superfamily c.55.3: Ribonuclease H-like [53098] (15 families)
   consists of one domain of this fold

5. Family c.55.3.2: Retroviral integrase, catalytic domain [53107] (2 proteins)

6. Protein Retroviral integrase, catalytic domain [53108] (4 species)

7. Species Human immunodeficiency virus type 1 [TaxId:11676] [53110] (44 PDB entries)

8. Domain d2b4jb_: 2b4j B: [127834]
   Other proteins in same PDB: d2b4jc1, d2b4jd_
   automated match to d1bi4c_
   complexed with gol, po4

Details for d2b4jb_

PDB Entry: 2b4j, 2.02 Å

PDB Description: structural basis for the recognition between hiv-1 integrase and ledgf/p75

PDB Compounds: (B:) Integrase (IN)

SCOPe Domain Sequences for d2b4jb_:

Sequence, based on SEQRES records:

>d2b4jb_ c.55.3.2 (B:) Retroviral integrase, catalytic domain {Human immunodeficiency virus type 1 [TaxId: 11676]}
spgiwqldcthlegkvilvavhvasgyieaevipaetgqetayfllklagrwpvktvhtd
ngsnftsttvkaacwwagikqefgipynpqsqgviesmnkelkkiigqvrdqaehlktav
qmavfihnkkrkggiggysagerivdiiatdi

Sequence, based on observed residues (ATOM records):

>d2b4jb_ c.55.3.2 (B:) Retroviral integrase, catalytic domain {Human immunodeficiency virus type 1 [TaxId: 11676]}
spgiwqldcthlegkvilvavhvasgyieaevipaetgqetayfllklagrwpvktvhtd
ngsnftsttvkaacwwagikqefgipynpqsqgviesmnkelkkiigqvrdqaehlktav
qmavfihnkkrsagerivdiiatdi

Timeline for d2b4jb_:

• d2b4jb_ first appeared in SCOP 1.73, called d2b4jb1
  
• d2b4jb_ appears in SCOPe 2.04
  
• d2b4jb_ appears in SCOPe 2.06
  
• d2b4jb_ appears in the current release, SCOPe 2.08