SCOP 1.73: Domain d2b4jb1: 2b4j B:57-208

Lineage for d2b4jb1 (2b4j B:57-208)

1. Root: SCOP 1.73

2. Class c: Alpha and beta proteins (a/b) [51349] (141 folds)

3. Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
   3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest

4. Superfamily c.55.3: Ribonuclease H-like [53098] (12 families)
   consists of one domain of this fold

5. Family c.55.3.2: Retroviral integrase, catalytic domain [53107] (1 protein)

6. Protein Retroviral integrase, catalytic domain [53108] (3 species)

7. Species Human immunodeficiency virus type 1 [TaxId:11676] [53110] (18 PDB entries)

8. Domain d2b4jb1: 2b4j B:57-208 [127834]
   Other proteins in same PDB: d2b4jc1, d2b4jd1
   automatically matched to d1biza_
   complexed with gol, po4; mutant

Details for d2b4jb1

PDB Entry: 2b4j, 2.02 Å

PDB Description: structural basis for the recognition between hiv-1 integrase and ledgf/p75

PDB Compounds: (B:) Integrase (IN)

SCOP Domain Sequences for d2b4jb1:

Sequence, based on SEQRES records:

>d2b4jb1 c.55.3.2 (B:57-208) Retroviral integrase, catalytic domain {Human immunodeficiency virus type 1 [TaxId: 11676]}
spgiwqldcthlegkvilvavhvasgyieaevipaetgqetayfllklagrwpvktvhtd
ngsnftsttvkaacwwagikqefgipynpqsqgviesmnkelkkiigqvrdqaehlktav
qmavfihnkkrkggiggysagerivdiiatdi

Sequence, based on observed residues (ATOM records):

>d2b4jb1 c.55.3.2 (B:57-208) Retroviral integrase, catalytic domain {Human immunodeficiency virus type 1 [TaxId: 11676]}
spgiwqldcthlegkvilvavhvasgyieaevipaetgqetayfllklagrwpvktvhtd
ngsnftsttvkaacwwagikqefgipynpqsqgviesmnkelkkiigqvrdqaehlktav
qmavfihnkkrsagerivdiiatdi

Timeline for d2b4jb1:

• d2b4jb1 is new in SCOP 1.73
  
• d2b4jb1 appears in SCOP 1.75
  
• d2b4jb1 appears in the current release, SCOPe 2.08, called d2b4jb_