Lineage for d1bi4c_ (1bi4 C:)

  1. Root: SCOPe 2.05
  2. 1815291Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1857400Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
    3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest
  4. 1859086Superfamily c.55.3: Ribonuclease H-like [53098] (15 families) (S)
    consists of one domain of this fold
  5. 1859358Family c.55.3.2: Retroviral integrase, catalytic domain [53107] (2 proteins)
  6. 1859359Protein Retroviral integrase, catalytic domain [53108] (4 species)
  7. 1859365Species Human immunodeficiency virus type 1 [TaxId:11676] [53110] (44 PDB entries)
  8. 1859442Domain d1bi4c_: 1bi4 C: [33668]

Details for d1bi4c_

PDB Entry: 1bi4 (more details), 2.5 Å

PDB Description: catalytic domain of hiv-1 integrase
PDB Compounds: (C:) integrase

SCOPe Domain Sequences for d1bi4c_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1bi4c_ c.55.3.2 (C:) Retroviral integrase, catalytic domain {Human immunodeficiency virus type 1 [TaxId: 11676]}
mhgqvdcspgiwqldcthlegkvilvavhvasgyieaevipaetgqetayfllklagrwp
vktvhtdngsnftsttvkaacwwagikqefgipynpqsqgviesmnkelkkiigqvrdqa
ehlktavqmavfihnhkrkggiggysagerivdiiatdiq

SCOPe Domain Coordinates for d1bi4c_:

Click to download the PDB-style file with coordinates for d1bi4c_.
(The format of our PDB-style files is described here.)

Timeline for d1bi4c_: