Class b: All beta proteins [48724] (180 folds) |
Fold b.40: OB-fold [50198] (17 superfamilies) barrel, closed or partly opened n=5, S=10 or S=8; greek-key |
Superfamily b.40.6: MOP-like [50331] (4 families) |
Family b.40.6.3: ABC-transporter additional domain [50338] (4 proteins) probably stems out from the biMOP domain |
Protein Maltose transport protein MalK, C-terminal domain [63406] (2 species) |
Species Escherichia coli [TaxId:562] [101772] (15 PDB entries) |
Domain d2awnd1: 2awn D:236-371 [127465] Other proteins in same PDB: d2awna2, d2awna3, d2awnb2, d2awnb3, d2awnc2, d2awnc3, d2awnd2, d2awnd3 automated match to d1q12a1 complexed with adp, mg |
PDB Entry: 2awn (more details), 2.3 Å
SCOPe Domain Sequences for d2awnd1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2awnd1 b.40.6.3 (D:236-371) Maltose transport protein MalK, C-terminal domain {Escherichia coli [TaxId: 562]} spkmnflpvkvtataidqvqvelpmpnrqqvwlpvesrdvqvganmslgirpehllpsdi advilegevqvveqlgnetqihiqipsirqnlvyrqndvvlveegatfaiglpperchlf redgtacrrlhkepgv
Timeline for d2awnd1: