![]() | Class b: All beta proteins [48724] (180 folds) |
![]() | Fold b.40: OB-fold [50198] (17 superfamilies) barrel, closed or partly opened n=5, S=10 or S=8; greek-key |
![]() | Superfamily b.40.4: Nucleic acid-binding proteins [50249] (18 families) ![]() |
![]() | Family b.40.4.5: Cold shock DNA-binding domain-like [50282] (36 proteins) barrel, closed; n=5, S=8 |
![]() | Protein S1 domain of NusA [69265] (2 species) |
![]() | Species Mycobacterium tuberculosis [TaxId:1773] [69267] (3 PDB entries) |
![]() | Domain d2atwc1: 2atw C:108-183 [127312] Other proteins in same PDB: d2atwa2, d2atwa3, d2atwc2, d2atwc3 automatically matched to d1k0ra1 protein/RNA complex |
PDB Entry: 2atw (more details), 2.25 Å
SCOPe Domain Sequences for d2atwc1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2atwc1 b.40.4.5 (C:108-183) S1 domain of NusA {Mycobacterium tuberculosis [TaxId: 1773]} stregeivagviqrdsranarglvvvrigtetkasegvipaaeqvpgesyehgnrlrcyv vgvtrgareplitlsr
Timeline for d2atwc1: