SCOPe 2.05: Domain d2aerl2: 2aer L:87-142

Lineage for d2aerl2 (2aer L:87-142)

1. Root: SCOPe 2.05

2. Class g: Small proteins [56992] (92 folds)

3. Fold g.3: Knottins (small inhibitors, toxins, lectins) [57015] (19 superfamilies)
   disulfide-bound fold; contains beta-hairpin with two adjacent disulfides

4. Superfamily g.3.11: EGF/Laminin [57196] (8 families)

5. Family g.3.11.1: EGF-type module [57197] (23 proteins)

6. Protein automated matches [190092] (1 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187310] (71 PDB entries)

8. Domain d2aerl2: 2aer L:87-142 [126642]
   Other proteins in same PDB: d2aerh_, d2aerl1, d2aerl3, d2aert1, d2aert2
   automated match to d2a2ql2
   complexed with ben, ca, cl, fuc, glc, mg, na, zn

Details for d2aerl2

PDB Entry: 2aer, 1.87 Å

PDB Description: crystal structure of benzamidine-factor viia/soluble tissue factor complex.

PDB Compounds: (L:) Coagulation factor VII

SCOPe Domain Sequences for d2aerl2:

Sequence; same for both SEQRES and ATOM records:

>d2aerl2 g.3.11.1 (L:87-142) automated matches {Human (Homo sapiens) [TaxId: 9606]}
dqlicvnenggceqycsdhtgtkrscrchegyslladgvsctptveypcgkipile

Timeline for d2aerl2:

• d2aerl2 first appeared in SCOP 1.73
  
• d2aerl2 appears in SCOPe 2.04
  
• d2aerl2 appears in SCOPe 2.06
  
• d2aerl2 appears in the current release, SCOPe 2.08