Class g: Small proteins [56992] (92 folds) |
Fold g.3: Knottins (small inhibitors, toxins, lectins) [57015] (19 superfamilies) disulfide-bound fold; contains beta-hairpin with two adjacent disulfides |
Superfamily g.3.11: EGF/Laminin [57196] (8 families) |
Family g.3.11.1: EGF-type module [57197] (23 proteins) |
Protein automated matches [190092] (1 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [187310] (71 PDB entries) |
Domain d2aerl2: 2aer L:87-142 [126642] Other proteins in same PDB: d2aerh_, d2aerl1, d2aerl3, d2aert1, d2aert2 automated match to d2a2ql2 complexed with ben, ca, cl, fuc, glc, mg, na, zn |
PDB Entry: 2aer (more details), 1.87 Å
SCOPe Domain Sequences for d2aerl2:
Sequence; same for both SEQRES and ATOM records: (download)
>d2aerl2 g.3.11.1 (L:87-142) automated matches {Human (Homo sapiens) [TaxId: 9606]} dqlicvnenggceqycsdhtgtkrscrchegyslladgvsctptveypcgkipile
Timeline for d2aerl2: