Lineage for d2aert1 (2aer T:6-108)

  1. Root: SCOPe 2.05
  2. 1755445Class b: All beta proteins [48724] (176 folds)
  3. 1755446Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 1767525Superfamily b.1.2: Fibronectin type III [49265] (2 families) (S)
  5. 1767526Family b.1.2.1: Fibronectin type III [49266] (45 proteins)
    Pfam PF00041
  6. 1767626Protein Extracellular region of human tissue factor [49267] (2 species)
    tandem of fibronectin type III domains
  7. 1767627Species Human (Homo sapiens) [TaxId:9606] [49268] (34 PDB entries)
    Uniprot P13726 33-242
  8. 1767639Domain d2aert1: 2aer T:6-108 [126644]
    Other proteins in same PDB: d2aerh_, d2aerl1, d2aerl2, d2aerl3
    automatically matched to d1a21a1
    complexed with ben, ca, cl, fuc, glc, mg, na, zn

Details for d2aert1

PDB Entry: 2aer (more details), 1.87 Å

PDB Description: crystal structure of benzamidine-factor viia/soluble tissue factor complex.
PDB Compounds: (T:) tissue factor

SCOPe Domain Sequences for d2aert1:

Sequence, based on SEQRES records: (download)

>d2aert1 b.1.2.1 (T:6-108) Extracellular region of human tissue factor {Human (Homo sapiens) [TaxId: 9606]}
tvaaynltwkstnfktilewepkpvnqvytvqistksgdwkskcfyttdtecdltdeivk
dvkqtylarvfsypagnvestgsageplyenspeftpyletnl

Sequence, based on observed residues (ATOM records): (download)

>d2aert1 b.1.2.1 (T:6-108) Extracellular region of human tissue factor {Human (Homo sapiens) [TaxId: 9606]}
tvaaynltwkstnfktilewepkpvnqvytvqistksgdwkskcfyttdtecdltdeivk
dvkqtylarvfsypagngeplyenspeftpyletnl

SCOPe Domain Coordinates for d2aert1:

Click to download the PDB-style file with coordinates for d2aert1.
(The format of our PDB-style files is described here.)

Timeline for d2aert1: