Lineage for d1zxid1 (1zxi D:85-156)

  1. Root: SCOPe 2.01
  2. 901761Class a: All alpha proteins [46456] (284 folds)
  3. 916694Fold a.56: CO dehydrogenase ISP C-domain like [47740] (1 superfamily)
    core: 4 helices, bundle
  4. 916695Superfamily a.56.1: CO dehydrogenase ISP C-domain like [47741] (1 family) (S)
    contains 2Fe-2S cluster
  5. 916696Family a.56.1.1: CO dehydrogenase ISP C-domain like [47742] (6 proteins)
  6. 916710Protein Carbon monoxide (CO) dehydrogenase iron-sulfur protein, C-domain [47748] (2 species)
  7. 916711Species Hydrogenophaga pseudoflava [TaxId:47421] [47750] (3 PDB entries)
  8. 916713Domain d1zxid1: 1zxi D:85-156 [125778]
    Other proteins in same PDB: d1zxia2, d1zxib1, d1zxib2, d1zxic1, d1zxic2, d1zxid2, d1zxif1, d1zxif2
    automatically matched to d1ffua1
    complexed with cu, cum, fad, fes, mcn, po4

Details for d1zxid1

PDB Entry: 1zxi (more details), 1.7 Å

PDB Description: reconstituted co dehydrogenase from oligotropha carboxidovorans
PDB Compounds: (D:) Carbon monoxide dehydrogenase small chain

SCOPe Domain Sequences for d1zxid1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1zxid1 a.56.1.1 (D:85-156) Carbon monoxide (CO) dehydrogenase iron-sulfur protein, C-domain {Hydrogenophaga pseudoflava [TaxId: 47421]}
gtlsalqegfrmmhglqcgyctpgmimrshrllqenpspteaeirfgiggnlcrctgyqn
ivkaiqyaaaki

SCOPe Domain Coordinates for d1zxid1:

Click to download the PDB-style file with coordinates for d1zxid1.
(The format of our PDB-style files is described here.)

Timeline for d1zxid1: