Lineage for d1zxib1 (1zxi B:6-146)

  1. Root: SCOPe 2.01
  2. 1013083Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1024467Fold d.41: alpha/beta-Hammerhead [54664] (5 superfamilies)
    core: beta-BETA-alpha-beta-BETA-beta-alpha; contains a beta-hammerhead motif similar to that in barrel-sandwich hybrids
  4. 1024468Superfamily d.41.1: CO dehydrogenase molybdoprotein N-domain-like [54665] (1 family) (S)
  5. 1024469Family d.41.1.1: CO dehydrogenase molybdoprotein N-domain-like [54666] (6 proteins)
  6. 1024483Protein Carbon monoxide (CO) dehydrogenase molybdoprotein, N-domain [54672] (2 species)
  7. 1024489Species Oligotropha carboxidovorans, formerly Pseudomonas carboxydovorans [TaxId:40137] [54673] (6 PDB entries)
  8. 1024500Domain d1zxib1: 1zxi B:6-146 [125774]
    Other proteins in same PDB: d1zxia1, d1zxia2, d1zxib2, d1zxic1, d1zxic2, d1zxid1, d1zxid2, d1zxif1, d1zxif2
    automatically matched to d1n63b1
    complexed with cu, cum, fad, fes, mcn, po4

Details for d1zxib1

PDB Entry: 1zxi (more details), 1.7 Å

PDB Description: reconstituted co dehydrogenase from oligotropha carboxidovorans
PDB Compounds: (B:) Carbon monoxide dehydrogenase large chain

SCOPe Domain Sequences for d1zxib1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1zxib1 d.41.1.1 (B:6-146) Carbon monoxide (CO) dehydrogenase molybdoprotein, N-domain {Oligotropha carboxidovorans, formerly Pseudomonas carboxydovorans [TaxId: 40137]}
tveptsaeraeklqgmgckrkrvedirftqgkgnyvddvklpgmlfgdfvrsshaharik
sidtskakalpgvfavltaadlkplnlhymptlagdvqavladekvlfqnqevafvvakd
ryvaadaielvevdyeplpvl

SCOPe Domain Coordinates for d1zxib1:

Click to download the PDB-style file with coordinates for d1zxib1.
(The format of our PDB-style files is described here.)

Timeline for d1zxib1: