![]() | Class d: Alpha and beta proteins (a+b) [53931] (376 folds) |
![]() | Fold d.15: beta-Grasp (ubiquitin-like) [54235] (14 superfamilies) core: beta(2)-alpha-beta(2); mixed beta-sheet 2143 |
![]() | Superfamily d.15.4: 2Fe-2S ferredoxin-like [54292] (3 families) ![]() |
![]() | Family d.15.4.2: 2Fe-2S ferredoxin domains from multidomain proteins [54312] (13 proteins) |
![]() | Protein Carbone monoxide (CO) dehydrogenase iron-sulfur protein, N-domain [54320] (2 species) |
![]() | Species Hydrogenophaga pseudoflava [TaxId:47421] [54322] (3 PDB entries) |
![]() | Domain d1zxia2: 1zxi A:3-81 [125773] Other proteins in same PDB: d1zxia1, d1zxib1, d1zxib2, d1zxic1, d1zxic2, d1zxid1, d1zxif1, d1zxif2 automatically matched to d1ffud2 complexed with cu, cum, fad, fes, mcn, po4 |
PDB Entry: 1zxi (more details), 1.7 Å
SCOPe Domain Sequences for d1zxia2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1zxia2 d.15.4.2 (A:3-81) Carbone monoxide (CO) dehydrogenase iron-sulfur protein, N-domain {Hydrogenophaga pseudoflava [TaxId: 47421]} kahieltinghpvealveprtllihfireqqnltgahigcdtshcgactvdldgmsvksc tmfavqangasittiegma
Timeline for d1zxia2: