Class b: All beta proteins [48724] (180 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.2: Fibronectin type III [49265] (2 families) |
Family b.1.2.1: Fibronectin type III [49266] (45 proteins) Pfam PF00041 |
Protein Ephrin type-A receptor 1 [141063] (1 species) |
Species Mouse (Mus musculus) [TaxId:10090] [141064] (1 PDB entry) Uniprot Q60750 446-539 |
Domain d1x5aa1: 1x5a A:8-101 [121706] Other proteins in same PDB: d1x5aa2, d1x5aa3 |
PDB Entry: 1x5a (more details)
SCOPe Domain Sequences for d1x5aa1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1x5aa1 b.1.2.1 (A:8-101) Ephrin type-A receptor 1 {Mouse (Mus musculus) [TaxId: 10090]} aeslsglslklvkkeprqleltwagsrprnpggnlsyelhvlnqdeewhqmvleprvllt klqpdttyivrvrtltplgpgpfspdhefrtspp
Timeline for d1x5aa1: