SCOPe 2.01: Domain d1u5ib1: 1u5i B:11-159

Lineage for d1u5ib1 (1u5i B:11-159)

1. Root: SCOPe 2.01

2. Class a: All alpha proteins [46456] (284 folds)

3. Fold a.39: EF Hand-like [47472] (4 superfamilies)
   core: 4 helices; array of 2 hairpins, opened

4. Superfamily a.39.1: EF-hand [47473] (12 families)
   Duplication: consists of two EF-hand units: each is made of two helices connected with calcium-binding loop

5. Family a.39.1.8: Penta-EF-hand proteins [63550] (6 proteins)

6. Protein Calpain small (regulatory) subunit (domain VI) [47552] (3 species)

7. Species Norway rat (Rattus norvegicus) [TaxId:10116] [47554] (6 PDB entries)

8. Domain d1u5ib1: 1u5i B:11-159 [119550]
   Other proteins in same PDB: d1u5ia1, d1u5ia2, d1u5ia3
   automatically matched to d1np8a_
   mutant

Details for d1u5ib1

PDB Entry: 1u5i, 2.86 Å

PDB Description: crystal structure analysis of rat m-calpain mutant lys10 thr

PDB Compounds: (B:) Calpain small subunit 1

SCOPe Domain Sequences for d1u5ib1:

Sequence; same for both SEQRES and ATOM records:

>d1u5ib1 a.39.1.8 (B:11-159) Calpain small (regulatory) subunit (domain VI) {Norway rat (Rattus norvegicus) [TaxId: 10116]}
seeerqfrklfvqlagddmevsatelmnilnkvvtrhpdlktdgfgidtcrsmvavmdsd
ttgklgfeefkylwnnikkwqgiykrfdtdrsgtigsnelpgafeaagfhlnqhiysmii
rrysdetgnmdfdnfisclvrldamfraf

Timeline for d1u5ib1:

• d1u5ib1 first appeared in SCOP 1.73
  
• d1u5ib1 appears in SCOP 1.75
  
• d1u5ib1 appears in SCOPe 2.02
  
• d1u5ib1 appears in the current release, SCOPe 2.08, called d1u5ib_