Lineage for d1u5ib1 (1u5i B:11-159)

  1. Root: SCOP 1.73
  2. 631650Class a: All alpha proteins [46456] (258 folds)
  3. 640657Fold a.39: EF Hand-like [47472] (4 superfamilies)
    core: 4 helices; array of 2 hairpins, opened
  4. 640658Superfamily a.39.1: EF-hand [47473] (11 families) (S)
    Duplication: consists of two EF-hand units: each is made of two helices connected with calcium-binding loop
  5. 641308Family a.39.1.8: Penta-EF-hand proteins [63550] (6 proteins)
  6. 641322Protein Calpain small (regulatory) subunit (domain VI) [47552] (3 species)
  7. 641337Species Rat (Rattus norvegicus) [TaxId:10116] [47554] (6 PDB entries)
  8. 641345Domain d1u5ib1: 1u5i B:11-159 [119550]
    Other proteins in same PDB: d1u5ia1, d1u5ia2, d1u5ia3
    automatically matched to d1np8a_
    mutant

Details for d1u5ib1

PDB Entry: 1u5i (more details), 2.86 Å

PDB Description: crystal structure analysis of rat m-calpain mutant lys10 thr
PDB Compounds: (B:) Calpain small subunit 1

SCOP Domain Sequences for d1u5ib1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1u5ib1 a.39.1.8 (B:11-159) Calpain small (regulatory) subunit (domain VI) {Rat (Rattus norvegicus) [TaxId: 10116]}
seeerqfrklfvqlagddmevsatelmnilnkvvtrhpdlktdgfgidtcrsmvavmdsd
ttgklgfeefkylwnnikkwqgiykrfdtdrsgtigsnelpgafeaagfhlnqhiysmii
rrysdetgnmdfdnfisclvrldamfraf

SCOP Domain Coordinates for d1u5ib1:

Click to download the PDB-style file with coordinates for d1u5ib1.
(The format of our PDB-style files is described here.)

Timeline for d1u5ib1: