SCOPe 2.08: Domain d1tw0b2: 1tw0 B:1-147

Lineage for d1tw0b2 (1tw0 B:1-147)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.129: TBP-like [55944] (11 superfamilies)
   beta-alpha-beta(4)-alpha

4. Superfamily d.129.3: Bet v1-like [55961] (11 families)
   contains a single copy of this fold with a alpha-beta2 insertion after the first helix; there is a cavity between the beta-sheet and the long C-terminal helix

5. Family d.129.3.1: Pathogenesis-related protein 10 (PR10)-like [55962] (5 proteins)

6. Protein automated matches [190058] (11 species)
   not a true protein

7. Species Pachyrhizus erosus [TaxId:109171] [186778] (2 PDB entries)

8. Domain d1tw0b2: 1tw0 B:1-147 [119365]
   Other proteins in same PDB: d1tw0a1, d1tw0a2, d1tw0b3
   automated match to d1icxa_

Details for d1tw0b2

PDB Entry: 1tw0, 2.2 Å

PDB Description: Native crystal structure of SPE16

PDB Compounds: (B:) pathogenesis-related class 10 protein SPE-16

SCOPe Domain Sequences for d1tw0b2:

Sequence; same for both SEQRES and ATOM records:

>d1tw0b2 d.129.3.1 (B:1-147) automated matches {Pachyrhizus erosus [TaxId: 109171]}
gvfvfrdetsssvapaklykaltkdsdtiaqkidgpiqsielvegnggvgtikkitaneg
dktsfvlqkvdaideanlgydysivggtglpesleklsfetkvvagsgggsiskvtlkfh
tkgdaplsdavrddalakgagffkaie

Timeline for d1tw0b2:

• d1tw0b2 first appeared in SCOP 1.73, called d1tw0b1
  
• d1tw0b2 appears in SCOPe 2.07