Lineage for d1sqxg_ (1sqx G:)

  1. Root: SCOPe 2.06
  2. 2250849Class f: Membrane and cell surface proteins and peptides [56835] (59 folds)
  3. 2253581Fold f.23: Single transmembrane helix [81407] (42 superfamilies)
    not a true fold
  4. 2254451Superfamily f.23.13: Ubiquinone-binding protein QP-C of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) [81508] (1 family) (S)
    automatically mapped to Pfam PF02939
  5. 2254452Family f.23.13.1: Ubiquinone-binding protein QP-C of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) [81507] (2 proteins)
  6. 2254453Protein Ubiquinone-binding protein QP-C of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) [81506] (3 species)
    together with cytochrome b binds to ubiquinone
  7. 2254470Species Cow (Bos taurus) [TaxId:9913] [81503] (19 PDB entries)
    Uniprot P13271 #SP ! Uniprot P13271
  8. 2254481Domain d1sqxg_: 1sqx G: [119044]
    Other proteins in same PDB: d1sqxa1, d1sqxa2, d1sqxb1, d1sqxb2, d1sqxc1, d1sqxc2, d1sqxd1, d1sqxd2, d1sqxe1, d1sqxe2, d1sqxf_, d1sqxh_, d1sqxi_, d1sqxj_, d1sqxk_
    automated match to d1be3g_
    complexed with fes, hem, sma, uq2

Details for d1sqxg_

PDB Entry: 1sqx (more details), 2.6 Å

PDB Description: Crystal Structure Analysis of Bovine Bc1 with Stigmatellin A
PDB Compounds: (G:) Ubiquinol-cytochrome c reductase complex 14 kDa protein

SCOPe Domain Sequences for d1sqxg_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1sqxg_ f.23.13.1 (G:) Ubiquinone-binding protein QP-C of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) {Cow (Bos taurus) [TaxId: 9913]}
grqfghltrvrhvityslspfeqrafphyfskgipnvlrrtracilrvappfvafylvyt
wgtqefekskrknpa

SCOPe Domain Coordinates for d1sqxg_:

Click to download the PDB-style file with coordinates for d1sqxg_.
(The format of our PDB-style files is described here.)

Timeline for d1sqxg_: