PDB entry 1sqx

View 1sqx on RCSB PDB site
Description: Crystal Structure Analysis of Bovine Bc1 with Stigmatellin A
Class: oxidoreductase
Keywords: cytochrome bc1, Qo inhibitor, membrane protein, electron transport, OXIDOREDUCTASE
Deposited on 2004-03-21, released 2005-09-06
The last revision prior to the SCOPe 2.06 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2.6 Å
R-factor: 0.235
AEROSPACI score: 0.25 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Ubiquinol-cytochrome-c reductase complex core protein I, mitochondrial precursor
    Species: Bos taurus [TaxId:9913]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1sqxa1, d1sqxa2
  • Chain 'B':
    Compound: Ubiquinol-cytochrome-c reductase complex core protein 2, mitochondrial precursor
    Species: Bos taurus [TaxId:9913]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1sqxb1, d1sqxb2
  • Chain 'C':
    Compound: cytochrome b
    Species: Bos taurus [TaxId:9913]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1sqxc1, d1sqxc2
  • Chain 'D':
    Compound: Ubiquinol-cytochrome c reductase iron-sulfur subunit, mitochondrial precursor (EC 1.10.2.2) (Rieske iron-sulfur protein) (RISP) [Contains: Ubiquinol-cytochrome c reductase 8 kDa protein (Complex III subunit IX)]
    Species: Bos taurus [TaxId:9913]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1sqxd1, d1sqxd2
  • Chain 'E':
    Compound: Cytochrome c1, heme protein, mitochondrial
    Species: Bos taurus [TaxId:9913]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1sqxe1, d1sqxe2
  • Chain 'F':
    Compound: Ubiquinol-cytochrome c reductase complex 11 kDa protein
    Species: Bos taurus [TaxId:9913]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1sqxf_
  • Chain 'G':
    Compound: Ubiquinol-cytochrome c reductase complex 14 kDa protein
    Species: Bos taurus [TaxId:9913]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1sqxg_
  • Chain 'H':
    Compound: Ubiquinol-cytochrome c reductase complex 7.2 kDa protein
    Species: Bos taurus [TaxId:9913]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1sqxh_
  • Chain 'I':
    Compound: ubiquinol-cytochrome c reductase complex ubiquinone-binding protein qp-c
    Species: Bos taurus [TaxId:9913]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1sqxi_
  • Chain 'J':
    Compound: Ubiquinol-cytochrome c reductase complex 6.4 kDa protein
    Species: Bos taurus [TaxId:9913]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1sqxj_
  • Chain 'K':
    Compound: Ubiquinol-cytochrome c reductase iron-sulfur subunit, mitochondrial precursor (EC 1.10.2.2) (Rieske iron-sulfur protein) (RISP) [Contains: Ubiquinol-cytochrome c reductase 8 kDa protein (Complex III subunit IX)]
    Species: Bos taurus [TaxId:9913]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1sqxk_
  • Heterogens: FES, UQ2, HEM, SMA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1sqxA (A:)
    tatyaqalqsvpetqvsqldnglrvaseqssqptctvgvwidagsryeseknngagyfve
    hlafkgtknrpgnalekevesmgahlnaystrehtayyikalskdlpkavelladivqnc
    sledsqiekerdvilqelqendtsmrdvvfnylhatafqgtplaqsvegpsenvrklsra
    dlteylsrhykaprmvlaaagglehrqlldlaqkhfsglsgtydedavptlspcrftgsq
    ichredglplahvaiavegpgwahpdnvalqvanaiighydctygggahlssplasiaat
    nklcqsfqtfnicyadtgllgahfvcdhmsiddmmfvlqgqwmrlctsatesevlrgknl
    lrnalvshldgttpvcedigrslltygrriplaewesriaevdarvvrevcskyfydqcp
    avagfgpieqlpdynrirsgmfwlrf
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1sqxB (B:)
    slkvapkvkateapagvpphpqdleftrlpnglviaslenyapasriglfikagsryens
    nnlgtshllrlasslttkgassfkitrgieavggklsvtstrenmaytveclrddvdilm
    efllnvttapefrrwevaalqpqlridkavalqnpqahvienlhaaayrnalanslycpd
    yrigkvtpvelhdyvqnhftsarmaliglgvshpvlkqvaeqflnirgglglsgakakyh
    ggeireqngdslvhaalvaesaaigsaeanafsvlqhvlgagphvkrgsnatsslyqava
    kgvhqpfdvsafnasysdsglfgfytisqaasagdvikaaynqvktiaqgnlsnpdvqaa
    knklkagylmsvessegfldevgsqalaagsytppstvlqqidavadadvinaakkfvsg
    rksmaasgnlghtpfidel
    

    Sequence, based on observed residues (ATOM records): (download)
    >1sqxB (B:)
    vpphpqdleftrlpnglviaslenyapasriglfikagsryensnnlgtshllrlasslt
    tkgassfkitrgieavggklsvtstrenmaytveclrddvdilmefllnvttapefrrwe
    vaalqpqlridkavalqnpqahvienlhaaayrnalanslycpdyrigkvtpvelhdyvq
    nhftsarmaliglgvshpvlkqvaeqflnirgglglsgakakyhggeireqngdslvhaa
    lvaesaaigsaeanafsvlqhvlgagphvkrgsnatsslyqavakgvhqpfdvsafnasy
    sdsglfgfytisqaasagdvikaaynqvktiaqgnlsnpdvqaaknklkagylmsvesse
    gfldevgsqalaagsytppstvlqqidavadadvinaakkfvsgrksmaasgnlghtpfi
    del
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1sqxC (C:)
    mtnirkshplmkivnnafidlpapsnisswwnfgsllgiclilqiltglflamhytsdtt
    tafssvthicrdvnygwiirymhangasmfficlymhvgrglyygsytfletwnigvill
    ltvmatafmgyvlpwgqmsfwgatvitnllsaipyigtnlvewiwggfsvdkatltrffa
    fhfilpfiimaiamvhllflhetgsnnptgissdvdkipfhpyytikdilgalllilalm
    llvlfapdllgdpdnytpanplntpphikpewyflfayailrsipnklggvlalafsili
    lalipllhtskqrsmmfrplsqclfwalvadlltltwiggqpvehpyitigqlasvlyfl
    lilvlmptagtienkllkw
    

    Sequence, based on observed residues (ATOM records): (download)
    >1sqxC (C:)
    tnirkshplmkivnnafidlpapsnisswwnfgsllgiclilqiltglflamhytsdttt
    afssvthicrdvnygwiirymhangasmfficlymhvgrglyygsytfletwnigvilll
    tvmatafmgyvlpwgqmsfwgatvitnllsaipyigtnlvewiwggfsvdkatltrffaf
    hfilpfiimaiamvhllflhetgsnnptgissdvdkipfhpyytikdilgalllilalml
    lvlfapdllgdpdnytpanplntpphikpewyflfayailrsipnklggvlalafsilil
    alipllhtskqrsmmfrplsqclfwalvadlltltwiggqpvehpyitigqlasvlyfll
    ilvlmptagtienkllkw
    

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1sqxD (D:)
    sdlelhppsypwshrgllssldhtsirrgfqvykqvcsschsmdyvayrhlvgvcytede
    akalaeevevqdgpnedgemfmrpgklsdyfpkpypnpeaaraanngalppdlsyivrar
    hggedyvfslltgycepptgvslreglyfnpyfpgqaigmappiynevlefddgtpatms
    qvakdvctflrwaaepehdhrkrmglkmllmmglllplvyamkrhkwsvlksrklayrpp
    k
    

  • Chain 'E':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1sqxE (E:)
    shtdikvpdfsdyrrpevldstksskessearkgfsylvtatttvgvayaaknvvsqfvs
    smsasadvlamskieiklsdipegknmafkwrgkplfvrhrtkkeidqeaavevsqlrdp
    qhdlervkkpewviligvcthlgcvpianagdfggyycpchgshydasgrirkgpaplnl
    evpsyeftsddmvivg
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >1sqxF (F:)
    agrpavsassrwlegirkwyynaagfnklglmrddtihenddvkeairrlpenlyddrvf
    rikraldlsmrqqilpkeqwtkyeedksylepylkevirerkereewakk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1sqxF (F:)
    vsassrwlegirkwyynaagfnklglmrddtihenddvkeairrlpenlyddrvfrikra
    ldlsmrqqilpkeqwtkyeedksylepylkevirerkereewakk
    

  • Chain 'G':
    Sequence, based on SEQRES records: (download)
    >1sqxG (G:)
    grqfghltrvrhvityslspfeqrafphyfskgipnvlrrtracilrvappfvafylvyt
    wgtqefekskrknpaayendr
    

    Sequence, based on observed residues (ATOM records): (download)
    >1sqxG (G:)
    grqfghltrvrhvityslspfeqrafphyfskgipnvlrrtracilrvappfvafylvyt
    wgtqefekskrknpa
    

  • Chain 'H':
    Sequence, based on SEQRES records: (download)
    >1sqxH (H:)
    gdpkeeeeeeeelvdplttvreqceqlekcvkarerlelcdervssrsqteedcteelld
    flhardhcvahklfnslk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1sqxH (H:)
    elvdplttvreqceqlekcvkarerlelcdervssrsqteedcteelldflhardhcvah
    klfnslk
    

  • Chain 'I':
    Sequence, based on SEQRES records: (download)
    >1sqxI (I:)
    mlsvaarsgpfapvlsatsrgvagalrplvqaavpatsespvldlkrsvlcreslrgqaa
    grplvasvslnvpasvry
    

    Sequence, based on observed residues (ATOM records): (download)
    >1sqxI (I:)
    mlsvaarsgpfapvlsatsrgvagalrplvqaavpatsespvldlkrsvlcreslrg
    

  • Chain 'J':
    Sequence, based on SEQRES records: (download)
    >1sqxJ (J:)
    vaptltarlysllfrrtstfaltivvgalfferafdqgadaiyehinegklwkhikhkye
    nk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1sqxJ (J:)
    aptltarlysllfrrtstfaltivvgalfferafdqgadaiyehinegklwkhikhkyen
    

  • Chain 'K':
    Sequence, based on SEQRES records: (download)
    >1sqxK (K:)
    mltrflgpryrqlarnwvptaslwgavgavglvwatdwrlildwvpyingkfkkdd
    

    Sequence, based on observed residues (ATOM records): (download)
    >1sqxK (K:)
    mltrflgpryrqlarnwvptaslwgavgavglvwatdwrlildwvpyingkfk