![]() | Class f: Membrane and cell surface proteins and peptides [56835] (50 folds) |
![]() | Fold f.23: Single transmembrane helix [81407] (30 superfamilies) not a true fold |
![]() | Superfamily f.23.13: Ubiquinone-binding protein QP-C of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) [81508] (1 family) ![]() |
![]() | Family f.23.13.1: Ubiquinone-binding protein QP-C of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) [81507] (1 protein) |
![]() | Protein Ubiquinone-binding protein QP-C of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) [81506] (3 species) together with cytochrome b binds to ubiquinone |
![]() | Species Cow (Bos taurus) [TaxId:9913] [81503] (18 PDB entries) |
![]() | Domain d1sqxg1: 1sqx G:1-75 [119044] Other proteins in same PDB: d1sqxa1, d1sqxa2, d1sqxb1, d1sqxb2, d1sqxc1, d1sqxc2, d1sqxd1, d1sqxd2, d1sqxf1, d1sqxh1, d1sqxi1, d1sqxj1 automatically matched to d1be3g_ complexed with fes, hem, sma, uq2 |
PDB Entry: 1sqx (more details), 2.6 Å
SCOP Domain Sequences for d1sqxg1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1sqxg1 f.23.13.1 (G:1-75) Ubiquinone-binding protein QP-C of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) {Cow (Bos taurus) [TaxId: 9913]} grqfghltrvrhvityslspfeqrafphyfskgipnvlrrtracilrvappfvafylvyt wgtqefekskrknpa
Timeline for d1sqxg1: