Lineage for d1sqxd1 (1sqx D:1-195)

  1. Root: SCOP 1.73
  2. 631650Class a: All alpha proteins [46456] (258 folds)
  3. 633823Fold a.3: Cytochrome c [46625] (1 superfamily)
    core: 3 helices; folded leaf, opened
  4. 633824Superfamily a.3.1: Cytochrome c [46626] (8 families) (S)
    covalently-bound heme completes the core
  5. 634162Family a.3.1.3: Cytochrome bc1 domain [46676] (1 protein)
  6. 634163Protein Cytochrome bc1 domain [46677] (3 species)
  7. 634175Species Cow (Bos taurus) [TaxId:9913] [46678] (18 PDB entries)
  8. 634186Domain d1sqxd1: 1sqx D:1-195 [119041]
    Other proteins in same PDB: d1sqxa1, d1sqxa2, d1sqxb1, d1sqxb2, d1sqxc1, d1sqxc2, d1sqxd2, d1sqxf1, d1sqxg1, d1sqxh1, d1sqxi1, d1sqxj1
    automatically matched to d1be3d2
    complexed with fes, hem, sma, uq2

Details for d1sqxd1

PDB Entry: 1sqx (more details), 2.6 Å

PDB Description: Crystal Structure Analysis of Bovine Bc1 with Stigmatellin A
PDB Compounds: (D:) Ubiquinol-cytochrome c reductase iron-sulfur subunit, mitochondrial precursor (EC 1.10.2.2) (Rieske iron-sulfur protein) (RISP) [Contains: Ubiquinol-cytochrome c reductase 8 kDa protein (Complex III subunit IX)]

SCOP Domain Sequences for d1sqxd1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1sqxd1 a.3.1.3 (D:1-195) Cytochrome bc1 domain {Cow (Bos taurus) [TaxId: 9913]}
sdlelhppsypwshrgllssldhtsirrgfqvykqvcsschsmdyvayrhlvgvcytede
akalaeevevqdgpnedgemfmrpgklsdyfpkpypnpeaaraanngalppdlsyivrar
hggedyvfslltgycepptgvslreglyfnpyfpgqaigmappiynevlefddgtpatms
qvakdvctflrwaae

SCOP Domain Coordinates for d1sqxd1:

Click to download the PDB-style file with coordinates for d1sqxd1.
(The format of our PDB-style files is described here.)

Timeline for d1sqxd1: