SCOP 1.73: Domain d1sqxb2: 1sqx B:236-439

Lineage for d1sqxb2 (1sqx B:236-439)

1. Root: SCOP 1.73

2. Class d: Alpha and beta proteins (a+b) [53931] (334 folds)

3. Fold d.185: LuxS/MPP-like metallohydrolase [63410] (1 superfamily)
   core: beta-alpha-beta(2)-alpha(2); 2 layers: alpha/beta

4. Superfamily d.185.1: LuxS/MPP-like metallohydrolase [63411] (2 families)
   Share the same "active site motif" HxxEH located in the first core helix, but differ in one of the zinc-binding residues

5. Family d.185.1.1: MPP-like [63412] (6 proteins)
   Common fold elaborated with many additional structures; duplication: each family member consists of two similar domains of beta(2)-alpha(2)-beta(2)-alpha(5)-beta structure, but only the N-terminal domain of MPP beta chain binds the catalytic metal

6. Protein Cytochrome bc1 core subunit 2 [63409] (3 species)

7. Species Chicken (Gallus gallus) [TaxId:9031] [56001] (9 PDB entries)

8. Domain d1sqxb2: 1sqx B:236-439 [119038]
   Other proteins in same PDB: d1sqxa1, d1sqxa2, d1sqxc1, d1sqxc2, d1sqxd1, d1sqxd2, d1sqxf1, d1sqxg1, d1sqxh1, d1sqxi1, d1sqxj1
   automatically matched to d1bccb2
   complexed with fes, hem, sma, uq2

Details for d1sqxb2

PDB Entry: 1sqx, 2.6 Å

PDB Description: crystal structure analysis of bovine bc1 with stigmatellin a

PDB Compounds: (B:) Ubiquinol-cytochrome-c reductase complex core protein 2, mitochondrial precursor

SCOP Domain Sequences for d1sqxb2:

Sequence; same for both SEQRES and ATOM records:

>d1sqxb2 d.185.1.1 (B:236-439) Cytochrome bc1 core subunit 2 {Chicken (Gallus gallus) [TaxId: 9031]}
kakyhggeireqngdslvhaalvaesaaigsaeanafsvlqhvlgagphvkrgsnatssl
yqavakgvhqpfdvsafnasysdsglfgfytisqaasagdvikaaynqvktiaqgnlsnp
dvqaaknklkagylmsvessegfldevgsqalaagsytppstvlqqidavadadvinaak
kfvsgrksmaasgnlghtpfidel

Timeline for d1sqxb2:

• d1sqxb2 is new in SCOP 1.73
  
• d1sqxb2 appears in SCOP 1.75
  
• d1sqxb2 appears in the current release, SCOPe 2.08