Class f: Membrane and cell surface proteins and peptides [56835] (50 folds) |
Fold f.23: Single transmembrane helix [81407] (30 superfamilies) not a true fold |
Superfamily f.23.11: Cytochrome c1 subunit of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase), transmembrane anchor [81496] (1 family) |
Family f.23.11.1: Cytochrome c1 subunit of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase), transmembrane anchor [81495] (1 protein) |
Protein Cytochrome c1 subunit of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase), transmembrane anchor [81494] (3 species) |
Species Cow (Bos taurus) [TaxId:9913] [81491] (18 PDB entries) |
Domain d1sqxd2: 1sqx D:196-241 [119042] Other proteins in same PDB: d1sqxa1, d1sqxa2, d1sqxb1, d1sqxb2, d1sqxc1, d1sqxc2, d1sqxd1, d1sqxf1, d1sqxg1, d1sqxh1, d1sqxi1, d1sqxj1 automatically matched to d1be3d3 complexed with fes, hem, sma, uq2 |
PDB Entry: 1sqx (more details), 2.6 Å
SCOP Domain Sequences for d1sqxd2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1sqxd2 f.23.11.1 (D:196-241) Cytochrome c1 subunit of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase), transmembrane anchor {Cow (Bos taurus) [TaxId: 9913]} pehdhrkrmglkmllmmglllplvyamkrhkwsvlksrklayrppk
Timeline for d1sqxd2: