SCOP 1.73: Domain d1sqxd2: 1sqx D:196-241

Lineage for d1sqxd2 (1sqx D:196-241)

1. Root: SCOP 1.73

2. Class f: Membrane and cell surface proteins and peptides [56835] (50 folds)

3. Fold f.23: Single transmembrane helix [81407] (30 superfamilies)
   not a true fold

4. Superfamily f.23.11: Cytochrome c1 subunit of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase), transmembrane anchor [81496] (1 family)

5. Family f.23.11.1: Cytochrome c1 subunit of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase), transmembrane anchor [81495] (1 protein)

6. Protein Cytochrome c1 subunit of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase), transmembrane anchor [81494] (3 species)

7. Species Cow (Bos taurus) [TaxId:9913] [81491] (18 PDB entries)

8. Domain d1sqxd2: 1sqx D:196-241 [119042]
   Other proteins in same PDB: d1sqxa1, d1sqxa2, d1sqxb1, d1sqxb2, d1sqxc1, d1sqxc2, d1sqxd1, d1sqxf1, d1sqxg1, d1sqxh1, d1sqxi1, d1sqxj1
   automatically matched to d1be3d3
   complexed with fes, hem, sma, uq2

Details for d1sqxd2

PDB Entry: 1sqx, 2.6 Å

PDB Description: crystal structure analysis of bovine bc1 with stigmatellin a

PDB Compounds: (D:) Ubiquinol-cytochrome c reductase iron-sulfur subunit, mitochondrial precursor (EC 1.10.2.2) (Rieske iron-sulfur protein) (RISP) [Contains: Ubiquinol-cytochrome c reductase 8 kDa protein (Complex III subunit IX)]

SCOP Domain Sequences for d1sqxd2:

Sequence; same for both SEQRES and ATOM records:

>d1sqxd2 f.23.11.1 (D:196-241) Cytochrome c1 subunit of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase), transmembrane anchor {Cow (Bos taurus) [TaxId: 9913]}
pehdhrkrmglkmllmmglllplvyamkrhkwsvlksrklayrppk

Timeline for d1sqxd2:

• d1sqxd2 is new in SCOP 1.73
  
• d1sqxd2 appears in SCOP 1.75
  
• d1sqxd2 appears in the current release, SCOPe 2.08