Lineage for d1y02a2 (1y02 A:20-70)

  1. Root: SCOPe 2.02
  2. 1239924Class g: Small proteins [56992] (90 folds)
  3. 1246041Fold g.50: FYVE/PHD zinc finger [57902] (1 superfamily)
    dimetal(zinc)-bound alpha+beta fold
  4. 1246042Superfamily g.50.1: FYVE/PHD zinc finger [57903] (4 families) (S)
  5. 1246043Family g.50.1.1: FYVE, a phosphatidylinositol-3-phosphate binding domain [57904] (6 proteins)
  6. 1246056Protein Rififylin (FYVE-RING finger protein Sakura) [118326] (1 species)
  7. 1246057Species Human (Homo sapiens) [TaxId:9606] [118327] (1 PDB entry)
    Uniprot Q8WZ73 45-139
  8. 1246058Domain d1y02a2: 1y02 A:20-70 [116279]
    Other proteins in same PDB: d1y02a1
    complexed with zn

Details for d1y02a2

PDB Entry: 1y02 (more details), 1.8 Å

PDB Description: Crystal Structure of a FYVE-type domain from caspase regulator CARP2
PDB Compounds: (A:) FYVE-RING finger protein SAKURA

SCOPe Domain Sequences for d1y02a2:

Sequence, based on SEQRES records: (download)

>d1y02a2 g.50.1.1 (A:20-70) Rififylin (FYVE-RING finger protein Sakura) {Human (Homo sapiens) [TaxId: 9606]}
psckscgahfantarkqtcldckknfcmtcssqvgngprlcllcqrfrata

Sequence, based on observed residues (ATOM records): (download)

>d1y02a2 g.50.1.1 (A:20-70) Rififylin (FYVE-RING finger protein Sakura) {Human (Homo sapiens) [TaxId: 9606]}
psckscgahfantarkqtcldckknfcmtcssqprlcllcqrfrata

SCOPe Domain Coordinates for d1y02a2:

Click to download the PDB-style file with coordinates for d1y02a2.
(The format of our PDB-style files is described here.)

Timeline for d1y02a2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1y02a1