SCOP 1.71: Domain d1y02a2: 1y02 A:20-70

Lineage for d1y02a2 (1y02 A:20-70)

1. Root: SCOP 1.71

2. Class g: Small proteins [56992] (79 folds)

3. Fold g.50: FYVE/PHD zinc finger [57902] (1 superfamily)
   dimetal(zinc)-bound alpha+beta fold

4. Superfamily g.50.1: FYVE/PHD zinc finger [57903] (3 families)

5. Family g.50.1.1: FYVE, a phosphatidylinositol-3-phosphate binding domain [57904] (6 proteins)

6. Protein Rififylin (FYVE-RING finger protein Sakura) [118326] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [118327] (1 PDB entry)

8. Domain d1y02a2: 1y02 A:20-70 [116279]
   Other proteins in same PDB: d1y02a1
   complexed with zn

Details for d1y02a2

PDB Entry: 1y02, 1.8 Å

PDB Description: Crystal Structure of a FYVE-type domain from caspase regulator CARP2

SCOP Domain Sequences for d1y02a2:

Sequence, based on SEQRES records:

>d1y02a2 g.50.1.1 (A:20-70) Rififylin (FYVE-RING finger protein Sakura) {Human (Homo sapiens)}
psckscgahfantarkqtcldckknfcmtcssqvgngprlcllcqrfrata

Sequence, based on observed residues (ATOM records):

>d1y02a2 g.50.1.1 (A:20-70) Rififylin (FYVE-RING finger protein Sakura) {Human (Homo sapiens)}
psckscgahfantarkqtcldckknfcmtcssqprlcllcqrfrata

Timeline for d1y02a2:

• d1y02a2 is new in SCOP 1.71
  
• d1y02a2 appears in SCOP 1.73
  
• d1y02a2 appears in the current release, SCOPe 2.08