Class g: Small proteins [56992] (100 folds) |
Fold g.50: FYVE/PHD zinc finger [57902] (2 superfamilies) dimetal(zinc)-bound alpha+beta fold |
Superfamily g.50.1: FYVE/PHD zinc finger [57903] (4 families) |
Family g.50.1.1: FYVE, a phosphatidylinositol-3-phosphate binding domain [57904] (6 proteins) |
Protein Rififylin (FYVE-RING finger protein Sakura) [118326] (1 species) |
Species Human (Homo sapiens) [TaxId:9606] [118327] (1 PDB entry) Uniprot Q8WZ73 45-139 |
Domain d1y02a2: 1y02 A:20-70 [116279] Other proteins in same PDB: d1y02a1 complexed with zn missing some secondary structures that made up less than one-third of the common domain |
PDB Entry: 1y02 (more details), 1.8 Å
SCOPe Domain Sequences for d1y02a2:
Sequence, based on SEQRES records: (download)
>d1y02a2 g.50.1.1 (A:20-70) Rififylin (FYVE-RING finger protein Sakura) {Human (Homo sapiens) [TaxId: 9606]} psckscgahfantarkqtcldckknfcmtcssqvgngprlcllcqrfrata
>d1y02a2 g.50.1.1 (A:20-70) Rififylin (FYVE-RING finger protein Sakura) {Human (Homo sapiens) [TaxId: 9606]} psckscgahfantarkqtcldckknfcmtcssqprlcllcqrfrata
Timeline for d1y02a2: