Lineage for d1xzwa1 (1xzw A:1-119)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2764739Superfamily b.1.12: Purple acid phosphatase, N-terminal domain [49363] (2 families) (S)
  5. 2764740Family b.1.12.1: Purple acid phosphatase, N-terminal domain [49364] (1 protein)
  6. 2764741Protein Purple acid phosphatase, N-terminal domain [49365] (2 species)
  7. 2764755Species Sweet potato (Ipomoea batatas) [TaxId:4120] [117063] (1 PDB entry)
    Uniprot Q9SE00 39-462
  8. 2764756Domain d1xzwa1: 1xzw A:1-119 [116270]
    Other proteins in same PDB: d1xzwa2, d1xzwb2
    complexed with fe, mn, nag, po4

Details for d1xzwa1

PDB Entry: 1xzw (more details), 2.5 Å

PDB Description: sweet potato purple acid phosphatase/phosphate complex
PDB Compounds: (A:) purple acid phosphatase

SCOPe Domain Sequences for d1xzwa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1xzwa1 b.1.12.1 (A:1-119) Purple acid phosphatase, N-terminal domain {Sweet potato (Ipomoea batatas) [TaxId: 4120]}
lpnaedvdmpwdsdvfavpsgynapqqvhitqgdyegrgviiswttpydkagankvfyws
ensksqkramgtvvtykyynytsafihhctikdleydtkyyyrlgfgdakrqfwfvtpp

SCOPe Domain Coordinates for d1xzwa1:

Click to download the PDB-style file with coordinates for d1xzwa1.
(The format of our PDB-style files is described here.)

Timeline for d1xzwa1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1xzwa2