Class a: All alpha proteins [46456] (289 folds) |
Fold a.80: post-AAA+ oligomerization domain-like [48018] (1 superfamily) core: 5 helices: bundle |
Superfamily a.80.1: post-AAA+ oligomerization domain-like [48019] (2 families) associated with N-terminal domain from the AAA+ family of P-loop hydrolases |
Family a.80.1.1: DNA polymerase III clamp loader subunits, C-terminal domain [48020] (9 proteins) contains an extra helix |
Protein gamma subunit [63578] (2 species) |
Species Escherichia coli [TaxId:562] [63579] (3 PDB entries) Uniprot P06710 5-368 |
Domain d1xxih1: 1xxi H:243-368 [116197] Other proteins in same PDB: d1xxia1, d1xxia2, d1xxib2, d1xxic2, d1xxid2, d1xxie1, d1xxie2, d1xxif1, d1xxif2, d1xxig2, d1xxih2, d1xxii2, d1xxij1, d1xxij2 protein/DNA complex; complexed with adp, po4, zn |
PDB Entry: 1xxi (more details), 4.1 Å
SCOPe Domain Sequences for d1xxih1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1xxih1 a.80.1.1 (H:243-368) gamma subunit {Escherichia coli [TaxId: 562]} tldddqalslveamveangervmalineaaargieweallvemlgllhriamvqlspaal gndmaaielrmrelartipptdiqlyyqtlligrkelpyapdrrmgvemtllralafhpr mplpep
Timeline for d1xxih1: